KEGG   Pseudomonas balearica: CL52_15750Help
Entry
CL52_15750        CDS       T03573                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00480  Glutathione metabolism
pbm00590  Arachidonic acid metabolism
pbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CL52_15750
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CL52_15750
Enzymes [BR:pbm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CL52_15750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AJE16418
UniProt: A0A1G9WEI1
Position
complement(3356011..3356493)
Genome map
AA seq 160 aa AA seqDB search
MSAFHQLVLPALGGGELPLSQYADRLLLVVNVASHCGLTPQYAGLEQLYQRYAGRGLVVL
GIPCNQFAGQEPGSDEEIRSFCSLNYGVSFPLSAKLEVNGPQRHPLYRLLAGEGADFPGD
ITWNFEKFLVDTDGRVLGRFSPRTAPDDPALTQAVESALR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcatttcaccaactggtattgccggccctgggcggcggtgagctgccgctgtcg
cagtacgccgaccggctgctgctggtggtcaacgtcgcgtcgcattgtgggctgaccccg
cagtatgcaggcctggaacagctgtaccagcgttatgccggacgcgggctggtggtgctg
ggcattccctgcaaccagtttgccggccaggagccgggcagcgacgaggagattcgctcg
ttctgttcgctcaactacggcgtcagctttccgctcagtgccaagctggaagtcaatggc
ccgcaacggcaccccctttatcgcctgctggccggcgagggcgcggatttcccgggcgat
atcacctggaacttcgaaaaattcctcgtcgacaccgacggtcgcgtgctggggcgcttt
tcgccgcgtacggcgccggacgatccggcactgactcaggcggtggagagtgcgctgcgc
tga

DBGET integrated database retrieval system