KEGG   Pseudomonas balearica: CL52_17085Help
Entry
CL52_17085        CDS       T03573                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00350  Tyrosine metabolism
pbm00643  Styrene degradation
pbm01100  Metabolic pathways
pbm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CL52_17085
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    CL52_17085
Enzymes [BR:pbm01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     CL52_17085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2
Motif
Other DBs
NCBI-ProteinID: AJE16668
UniProt: A0A1G9VNT9
Position
complement(3624304..3624954)
Genome map
AA seq 216 aa AA seqDB search
MLKLYGYWRSSAAYRVRIALNLKGLAYRQVPVHLVKDGGQQHAAEYRALNPQRLVPLLVD
EVNGGARIAQSLAILEYLDEVFPVPALLPDDPVRRAQVRALAMHIACDIHPLNNLRVLKY
LSGELGVDDEAKNAWYRHWVTEGLASVEVGLEAFGDELSLGQRPGYLEACLVPQVYNARR
FDCPMDAYPRILARVARCEALEAFTHAAPEVQPDAG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactctacggctactggcgctccagcgccgcctaccgcgtgcgcatcgcgctg
aacctcaagggcctggcctatcgccaggtgccggtgcatctggtcaaggacggcggccag
cagcacgccgccgagtaccgcgcgctcaacccgcagaggctggtgccgctgctggtcgac
gaggtcaacggcggcgcgcgcatcgcccagtcgctggcgatcctcgagtacctcgacgag
gtgtttccggtgccggcgctgctgccggacgatccggtgcgccgcgcccaggtgcgcgca
ctggccatgcacatcgcctgcgatatccacccgttgaacaacctgcgcgtgctcaagtac
ctgtccggcgagctcggcgtcgacgacgaggcgaagaatgcctggtaccggcactgggtc
accgagggcctggcgtcggtggaggtggggctggaagcctttggtgacgagctgtcgctg
ggccagcggcccggctatctcgaagcctgcctggtgccgcaggtgtacaacgcccgccgt
ttcgactgcccaatggacgcctatccacgtatcctcgcgcgggttgctcgctgcgaggcg
ctggaggcattcacccatgccgccccggaggtgcaacccgacgctggctga

DBGET integrated database retrieval system