KEGG   Paracoccidioides brasiliensis Pb18: PADG_00215Help
Entry
PADG_00215        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn00350  Tyrosine metabolism
pbn00360  Phenylalanine metabolism
pbn00380  Tryptophan metabolism
pbn00901  Indole alkaloid biosynthesis
pbn01100  Metabolic pathways
pbn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PADG_00215
   00360 Phenylalanine metabolism
    PADG_00215
   00380 Tryptophan metabolism
    PADG_00215
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    PADG_00215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbn04147]
    PADG_00215
Enzymes [BR:pbn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     PADG_00215
    4.1.1.105  L-tryptophan decarboxylase
     PADG_00215
Exosome [BR:pbn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PADG_00215
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 22580092
NCBI-ProteinID: XP_010755737
UniProt: C1G025
Position
Unknown
AA seq 537 aa AA seqDB search
MDQEEFREAAHLAVEDIIKYFNTIVSKRVVPDVEPGYLRPLLPTSVPKDPEPWSKIHGDI
ESKIIPGLTHWQSPKFMAFFPSCVTYPSIIGEMYSAAFTAAAFNWLCSPACTELEIVMMD
WLAQALGLPDCFLSAASSKSGKSTGGGVIQGSASEAIATVIVAARERHVRAKAAAEGLVE
DTPEWEDRIMELRPRLVALASDQGHSCTAKGARIAGVRYRAIPTRLEDNLELTGDALRKV
LEQCARDGLEPFYLTATMGTTNSCAIDRLAEIKAVLKEKESWQNIWVHIDAAYAGSALVA
EEYQYIAKEFAEGVDSFDMDMAKWLLVNFDTSCLFLRNTSDLTNSLDIAPAYLRNPSTLT
SPVTDFRHWQFSLGRRFRALKVWFVMRSYGLSGMKAHIRKGVNIGRVFVDLVRSRDDIFE
VFTKPAFGLTVVRIKGLDEVDPNSVPVQNGVARNTLTNGTTKPAFSSGAITRKVCETINA
RGEIFLTCTVIHERPVIRVVNGNTMSEEKYMRRAFDILVSVSEEVLAEQRQSRAVKN
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggaccaagaagaattcagagaagcggctcaccttgccgttgaagatataatcaaatac
ttcaacaccatcgtctccaagagagtcgttcccgatgtagagccagggtaccttcgtcct
cttcttcccacatcggttcccaaggacccagagccatggagcaagatacacggggacatc
gagtccaaaatcattccaggactcacccactggcaatcgccaaagttcatggcttttttt
ccctcttgtgtgacttacccttccatcattggtgaaatgtactcggccgccttcaccgcg
gcagctttcaattggctgtgctctcctgcatgtacggaattggaaattgtcatgatggac
tggctggcacaggcattgggactaccggattgcttccttagtgctgcgtcatcaaaatct
gggaagagcacgggtggtggtgttatccagggaagcgccagcgaggctattgcaaccgtc
atagttgccgctcgtgaacgacatgtccgggctaaagctgcagcggaggggctggttgaa
gacacgccagagtgggaagatcgcattatggaactacgcccacgccttgtcgcactggcc
agtgatcagggacacagctgtacagctaagggggcccggattgcaggtgttcgataccgg
gccatcccgacgcgactagaagacaacctggaattgaccggggatgcgttgcgcaaggtt
ctggaacaatgtgcgagagacgggcttgaacctttctatttaacagctacaatgggcaca
accaattcctgtgccatagaccggcttgcggagatcaaagctgtgctaaaggagaaggaa
tcatggcagaacatttgggtgcatattgatgccgcatatgctgggtccgcgcttgtggcg
gaggagtatcagtacattgcgaaggagttcgcagaaggcgtcgatagttttgatatggat
atggcaaagtggcttctagtaaattttgacactagttgcctcttccttcgcaatacaagc
gacctcaccaactctctggacattgcgcccgcctacttgcgaaatccaagcacgcttact
tccccagtgactgactttcgccattggcaattttcacttgggagacgcttccgcgcactc
aaagtgtggtttgtcatgcgttcgtacgggctttctggcatgaaagcacatatccgtaag
ggggtaaacattggccgcgtctttgttgatctcgttagaagccgcgatgatatttttgag
gtctttacaaagccggcctttggattgacggttgtcagaattaagggattggatgaagtt
gatccaaacagtgtccccgtgcaaaacggtgtcgctcgcaataccttgaccaatggcacg
accaaaccagcattctcttcaggagctattactcggaaagtttgcgaaactatcaatgcc
cgaggagaaatattcctgacatgtacggtaatccacgagcgcccggtcatccgggtagta
aatggaaatacaatgtcagaggagaaatatatgcgacgtgcatttgatatcttggttagt
gtgagtgaagaggtcctggcggaacagagacaaagcagggctgtgaaaaactag

DBGET integrated database retrieval system