KEGG   Paracoccidioides brasiliensis: PADG_00480
Entry
PADG_00480        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pbn  Paracoccidioides brasiliensis
Pathway
pbn00100  Steroid biosynthesis
pbn01100  Metabolic pathways
pbn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    PADG_00480
Enzymes [BR:pbn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     PADG_00480
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 22580312
NCBI-ProteinID: XP_010756366
UniProt: C1G0U0
Position
Unknown
AA seq 499 aa
MGQKSVKKAASPPVATPYQKHGYEFFGPPGVSILLIVLPIIVYIFPFVCNDISGCPAPSL
LHPSTLSLETLKREVGWPENGLKGLYDTQVTCYVLGYYLLLLVLQIVLPGEEVEGVLLAC
GGRHRYKFNSFLSAVLILGGSAAGSYIYGPDFPVWTFLWDNYIQVLTANLIISEALAAFV
YLASFTVPAPGKLNPTFRELAPGGTSGNPIYDFFMGRELNPRIRLPIPFVSEASKILDIK
AFCEIRPGLLGWIILNLSNIAHQYKVNSGHITISIILITFFQGFYVLDALYMEPAILTTM
DMITDGFGFMLSFGDLVWVPFIYSVQTRYLAVYPLDIGLWGLAVVLGVQSVGYYIFRSTN
NQKNRFRTNPNDPRVKHLKYVETAAGSRLLISGWWGCARHINYMGDWVMSWSYCLPTGIA
GYLIVDKINPITGATEKRAVQTPEVRGWGNLVTYFFMLYFAILLLHRERRDEAKCRRKYG
KDWDRYTSIVKSRIIPGIY
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgggccaaaaaagtgtgaagaaggccgccagcccccctgtcgcaactccatatcaaaaa
catggatatgagttctttggacctcctggagtgtctatcttactcattgtccttccaatt
atcgtatatatattcccgtttgtctgcaacgatatttctgggtgcccagcaccgtccctg
ctccacccgtcgactctttcgcttgaaactttaaaacgagaagttggatggcctgagaac
ggactgaaaggactatacgatacccaggttacttgctatgttcttggctactacctactc
ctgctggtgttgcagattgtgcttccaggggaagaggtggaaggagtcctgctagcttgc
ggagggaggcatagatataaattcaactcttttctctctgctgttttgattttgggagga
tctgccgctgggagttatatctatggacccgatttccctgtgtggacattcctctgggac
aattatatccaagttctcaccgcaaatcttattatcagcgaagcactcgcagctttcgtt
taccttgcaagtttcaccgttccagcacctggaaaactcaaccccacattccgtgaacta
gctccgggcggcaccagtggcaatccaatatacgatttcttcatgggccgtgaactaaac
ccgcgaatccgtcttcctatcccctttgttagcgaagcttccaagatactcgatattaaa
gccttctgcgagatacgacccggcctgttgggctggataattttgaatttatccaacatc
gctcaccaatacaaggtcaattcgggacacatcaccatatcgatcattctcattaccttc
ttccagggtttctatgtgcttgacgccctctacatggagcctgctatccttacaacaatg
gatatgattaccgatgggtttggtttcatgttgtcattcggggatttggtctgggtacca
ttcatctattccgtgcaaacaagatacctcgcggtttatccgttagatattggcctctgg
ggcctcgctgtcgtcttgggagttcaatcagtcggatattacatcttccgcagcaccaac
aaccaaaagaaccgattccgcacgaatcctaatgatccacgagtgaagcacctcaaatat
gtcgaaactgctgctggttcccgtcttctgatatcggggtggtggggttgtgctcgccac
attaattatatgggcgattgggtgatgtcttggtcatattgccttcccactggcattgct
gggtatctgattgttgacaaaattaatcctatcacgggtgccactgagaagcgtgcagtc
caaactcccgaggtacgtggttggggcaacctagttacatacttctttatgttgtatttt
gccattctgctcctccatcgtgagagaagagacgaggcaaagtgcagaaggaagtacggc
aaggattgggacagatacacatccatcgtgaaaagcaggatcataccagggatttattag

DBGET integrated database retrieval system