KEGG   Paracoccidioides brasiliensis Pb18: PADG_00630Help
Entry
PADG_00630        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn00051  Fructose and mannose metabolism
pbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PADG_00630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbn04147]
    PADG_00630
Enzymes [BR:pbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     PADG_00630
Exosome [BR:pbn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PADG_00630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 22580442
NCBI-ProteinID: XP_010755911
UniProt: C1G190
Position
Unknown
AA seq 347 aa AA seqDB search
MRALVTIGACYLDTILTVDHYPGEDEKLRASSISRRRGGNTLNTLEVLQQLLESRSQNAQ
AAEGDGHTNINGDNSRNDVDNTPLLYAVAVLPAKSSPAIREIKASFGPYVDLQHLIYREE
CSEPASSYIIKSTSTGTRTIVNYNELPEMTVAEFVRIAESLSTATTPPARPRWFHFEGRI
PDVTLECIRYIRQKFPADKVSVEVEKPGRSGLQELAAVVDVVFYSKTWAQANGYQSPSDF
LQWQAPLTPVASILCCTWGDRGAACLDTRSMSYIHCPAYIDLRSPVVVDTIGAGDTFIAG
MLYGLIYHGDDSDFSLQLTLDFANRLAAYKVMQEGFGGLGEAVAKSL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagagctcttgtgactattggtgcatgttatctcgacactatcctaaccgtcgaccac
tacccaggagaagacgaaaagctacgtgcatccagcatctcgcgacggcggggcggaaac
accctcaacacgcttgaagttctccaacaactcctcgaaagcagatcacaaaatgcccag
gctgccgaaggcgatggacataccaacatcaatggtgataatagtcgaaatgatgttgac
aacactccccttctatatgccgttgcagtgctgccagcaaaatcatctcccgcaatcagg
gaaataaaagcatcctttggtccatatgttgacctccagcacctcatataccgagaagag
tgcagcgagccagcatccagctacatcatcaagagtacctcgacaggcaccaggactatc
gtcaactacaacgagttgccggagatgactgtggctgaatttgtgcggattgcggagagt
ttgtctaccgcaactacaccccccgcccgtcctcgatggtttcattttgagggccgcata
ccagatgtcacactggaatgcatacgatatattcgtcaaaagttcccagccgataaagtc
agcgtggaagtcgagaagcctgggcgctcaggtcttcaggagctagctgctgtggtggat
gtggtgttttattccaaaacatgggcgcaggcaaatggttaccaatcgccgtcagatttt
cttcaatggcaggcccccttaacacccgtagcgtcaattctgtgctgcacatggggcgac
cggggcgccgcatgccttgacacgcgcagcatgtcatacatccattgcccagcgtatata
gatctgcgaagtccagttgtcgtcgatacgatcggggctggcgacacgtttattgcggga
atgctgtacggtttgatctatcatggcgacgacagtgacttcagtcttcagctgacactc
gattttgcgaaccgccttgccgcgtacaaggtcatgcaggaagggtttggagggctgggt
gaagctgtggcgaagagcttgtag

DBGET integrated database retrieval system