KEGG   Paracoccidioides brasiliensis Pb18: PADG_00697Help
Entry
PADG_00697        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn00480  Glutathione metabolism
pbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PADG_00697
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pbn02000]
    PADG_00697
Enzymes [BR:pbn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PADG_00697
Transporters [BR:pbn02000]
 Other transporters
  Pores ion channels [TC:1]
   PADG_00697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 22580497
NCBI-ProteinID: XP_010756462
UniProt: C1G1F7
Position
Unknown
AA seq 259 aa AA seqDB search
MPLTIHHLHSSQSERIPWLCEELNIPYELKTYKRDPIFAPPEYKALHPSGAAPVIQDTLP
TNDGGSDAEPQTLILAESCACVEYISHKYGNGRLFLPSTHKDYATFLYWFHWANGTFQPL
LGRLLTVETIMSSIGGGGGGNSNSRSETQNQTLGSNPLIALWSGRRQRALRMLDNRFKKR
DEGGEEATWLAGEEFTAADIIVVFSLTTFRNWYRYSLQEYKGILGYLQRIGGREGYRRAM
AQVDPEMTLALDAEPPVKM
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcccctaacaatccaccacctccactcctcccaatccgaacgcatcccctggctctgc
gaagaactaaacattccctatgagctgaaaacttacaagcgagatccaatcttcgctccg
cccgagtataaagcgctgcacccttccggtgccgctcctgtcattcaagatactcttccc
accaacgacggtggtagtgatgcagaaccgcaaaccctaatccttgctgaaagctgcgcc
tgcgtggagtatatcagccataaatatgggaatgggagattattcctaccctcaacacat
aaagactacgcaaccttcctctactggttccactgggcgaatgggacttttcagccgttg
ttgggacggcttttgacagtggagaccatcatgagcagtatcggcggcggcggcggcggc
aacagcaacagcaggagcgaaacccagaaccaaactcttggttccaatcccctgatagcc
ctctggagcggcagaagacagcgggcgctgaggatgctggacaatcgatttaagaaaagg
gacgaaggcggcgaagaggcgacatggttggctggtgaagagtttacggcggcggatatc
attgttgtgttttcgctaacgactttcaggaactggtatcgatatagtttgcaggaatat
aaagggattttgggctacttgcagaggattgggggcagagaggggtataggagggcgatg
gcccaagtggacccagaaatgacgttggcgttggacgcagagcccccggtgaaaatgtga

DBGET integrated database retrieval system