KEGG   Paracoccidioides brasiliensis Pb18: PADG_02991Help
Entry
PADG_02991        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn00071  Fatty acid degradation
pbn00410  beta-Alanine metabolism
pbn00592  alpha-Linolenic acid metabolism
pbn00640  Propanoate metabolism
pbn01040  Biosynthesis of unsaturated fatty acids
pbn01100  Metabolic pathways
pbn01110  Biosynthesis of secondary metabolites
pbn01200  Carbon metabolism
pbn01212  Fatty acid metabolism
pbn04146  Peroxisome
Module
pbn_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PADG_02991
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PADG_02991
   00592 alpha-Linolenic acid metabolism
    PADG_02991
   01040 Biosynthesis of unsaturated fatty acids
    PADG_02991
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PADG_02991
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PADG_02991
Enzymes [BR:pbn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     PADG_02991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 22582374
NCBI-ProteinID: XP_010758224
UniProt: C1G736
Position
Unknown
AA seq 682 aa AA seqDB search
MAPIPEWVKALKPAGPQGSELLQRERDSSNVSVDKLAELLHTKAVLDRQQKILAIMKNEK
VFDKSQNLSMGRVERLTASLGKAKRIQQLREQHNWTDEEFVMANNLLSEPTPYGLHASMF
LVTLRNQSTPEQAKLFLEPAERYEIIGCYAQTELGHGSNVQGLETTATWDPTDKTFVMHS
PTLTASKWWIGSLGKTANHAIVMAQLIISGKRYGPHPFVVPIRDLKTHEPLEGVHVGDIG
PKFGYNTMDNGFLLLNKVKIPHVNMLARFSHVDPATSEYVRPAAASLVYGTMTWVRSTIV
LQSGSVLARGVAIATRYCSIRRQFQDRDAKDKAAGENQVLDYKMVQIRILPLLAATFALH
FTGRRMMEMYEQNQKLITAGGSEKAGAILLADLHATSCGLKALGSTIAAEGLEVCRRACG
GHGYSSYSGIGPWYADYLPTTTWEGDNYMLTQQVARYLLKSARAVFAGQAPDNDTCRILK
GYLSRKDTGAAFDILDSDAEIVDAFAWRTAFLTFEALKHRDVEKRSWNSLLIDFYHLSTA
HSQYLVVKNFYEALSSPSTTSALDPDTTAVLWKLFRLFALNMLERESAEFFTSGAVTIRQ
ITLTRTKAVVTLLDEVRPHAVRLVDAWKFPDWQLDSSLGRSDGKVYEDLFYRASELNPAN
NITFDPYPSTDVLVKNKRQSKL
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggcccccattcccgagtgggtgaaggctttgaagcctgctggcccacagggttcagag
ctcctacagcgtgagcgggacagctcaaatgtctcagtcgacaagctggcggagctgctt
cataccaaggcggtgcttgacagacaacagaagattctggccatcatgaaaaacgagaaa
gtttttgataaatcccagaacctatcaatgggccgtgtggaacgactgacagcatccctc
gggaaggctaagcgcattcaacagctgagagagcagcacaactggacagacgaagaattc
gtgatggccaacaatcttctcagcgagcccaccccttacggtctccatgcgagcatgttt
ttggtcactctcagaaatcagtcgactccagagcaggcaaaacttttcctagagccagcg
gaacggtacgagatcattggctgctacgcccaaaccgagctcggtcatggatccaacgtt
caaggtctcgaaaccaccgcaacctgggaccccacagacaagactttcgtcatgcactcc
ccgaccctgaccgcttccaaatggtggattggctccttgggtaaaacggcaaaccacgcc
atagttatggcccaattgattattagtggcaaacgctacggacctcacccctttgtcgtg
ccaatccgcgacttgaagacacatgaaccactcgagggagttcatgtgggagatattgga
cctaaatttggttacaataccatggataatggattccttcttctgaacaaggttaagatc
ccacatgtaaacatgttggcacgcttctctcacgtggaccccgctacgagtgaatatgtg
cgcccggccgccgcttctctcgtctatggtactatgacctgggttcgatccactattgta
ttacaatccggcagcgtcctagcccgaggcgtcgcaattgccacgagatattgctctatt
cgaaggcagttccaggaccgcgatgcaaaagataaagccgctggcgaaaaccaggttctg
gattacaagatggttcagattcgaattctgcctctccttgctgctacgtttgctctccat
tttactggacggcgaatgatggagatgtacgaacaaaaccagaagctgataactgcgggt
ggctcagagaaggctggcgccatcctcctcgctgatctccacgccacctcctgtggcctg
aaagcccttggaagtacaatagctgctgaaggattagaagtatgccgtcgtgcgtgtggt
ggacatgggtatagtagctacagcggcatcggtccctggtatgctgattatttgccaaca
actacctgggagggagacaattacatgttgacccaacaagtcgcacgatacctccttaaa
tctgctagggcagtgttcgccggccaagccccggataacgacacctgccgtattctcaaa
ggctacctaagccgcaaagacacgggagccgccttcgatattcttgacagcgacgccgaa
atcgtagatgcttttgcatggcgtaccgctttcttgacgttcgaggcattgaagcaccgt
gatgtcgaaaagcgttcctggaatagtttgctcatcgatttctaccacctctctaccgct
cactcccaatatcttgtggtgaagaacttctacgaggccctctcctcacctagcacaaca
tctgccctcgaccctgacacgaccgcagtcctttggaaactcttccgtctattcgccctc
aatatgttagagcgtgaatccgccgagttcttcacctccggtgctgtgaccatccgtcaa
atcaccctcacacgaacgaaggcagtggtgaccctgcttgatgaggtcagaccccatgcc
gtccgacttgttgacgcatggaaattcccagactggcagctcgacagctcgttgggccgc
tccgatggcaaggtctacgaggacctgttctaccgagccagcgagctgaatcccgctaac
aatataacattcgacccgtatccgtctaccgacgtactggtgaagaataagagacaaagc
aagctttaa

DBGET integrated database retrieval system