KEGG   Paracoccidioides brasiliensis: PADG_03825Help
Entry
PADG_03825        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
  KO
K15371  glutamate dehydrogenase [EC:1.4.1.2]
Organism
pbn  Paracoccidioides brasiliensis
Pathway
pbn00220  Arginine biosynthesis
pbn00250  Alanine, aspartate and glutamate metabolism
pbn00430  Taurine and hypotaurine metabolism
pbn00910  Nitrogen metabolism
pbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PADG_03825
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PADG_03825
   00220 Arginine biosynthesis
    PADG_03825
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    PADG_03825
Enzymes [BR:pbn01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     PADG_03825
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELFV_dehydrog Bac_GDH ELFV_dehydrog_N
Motif
Other DBs
NCBI-GeneID: 22583064
NCBI-ProteinID: XP_010759615
UniProt: C1G989
Position
Unknown
AA seq 1118 aa AA seqDB search
MTPQGVTINPASTSNMEPAAATDNSVPKLVANGLSSTHFSMSTRPGLSPFSSKEGSGTGT
PTTGFQRPPLINKQLEMVIRTPGRQPSPQPTHLGIPGGTHRVLSEEGPGYVAAKFEGKKK
QMEAVMDELEEKGFIPSEFVPSETNWFYNMLGIDDMYFQTESVDAIVSHILSLYAAKVAA
YARDDKRLEIRLDKEAPDHAVYIDTSKPGISAFDGPRYEQRIDEKYINGCTPKNAYRVET
FRSASSLPDNHEQQLRCYFVYKCHFNEPHPDPEETNIEIVGEKRFLQKATANTKAIYQEI
IINAVARSGPVIEMFEIEGSREKRLVIAYRQGSAMGMFSALSDLYHYYRLTSSRKYLENF
SNGITVVSLYLKPMAGAEISGKHPPIEAAIHQIMKEISLLYCIPQNKFQGHFASGLLSLQ
ETIYAHCVWVFVQQFLNRLGSEYTSLTAILDSSNSSHAELLAKIKKRLRTETFTSDYILE
IINKYPQLIHKLYLDFAQTHYVQMVEGVPDDFLPTLSYLRLQVDEPLDQEGLDKLVSKTV
VSENDEMVMNSFRIFNNAVLKTNFYTPTKVALSFRLAADFLPEHEYPQRLYGMFLVISSE
FRGFHLRFRDIARGGIRIVKSRDKEAYAINARSLFDENYNLANTQQRKNKDIPEGGAKGV
ILLDVNHQNKARVAFEKYIDSILDLLLPPASPGIKDPIVDLHGQDEILFMGPDENTADLV
NWATEHARKRGAPWWKSFFTGKSPKLGGIPHDRYGMTTLSVRQYVLGIYRKLGIDPSTVR
KMQTGGPDGDLGSNEILLGNEKYCAIVDGSGVIVDPQGLDHDELVRLAKKRAMIVEFDKS
KLSPEGYRVLVDESNVVLPSGEVVHNGTVFRNTFHLREGRSFDMFVPCGGRPESIDLSNV
SRLIENGKTTIPYIVEGANLFLTQDSKLRLEKAGCVIFKDASVNKGGVTSSSLEVLASLS
FDDKGFEENMCVREDGTIPNFYVEYVREVQEIIQRNARLEFEAIWREHEETGMPRSMLSD
KLSIAITKLDEELQKTQLWEDRELRKAVLRDALPKLLLEKIGLETILERVPISYLRSIFG
SYLASRFVYEYGSSPSQFSFFDFMSKRSAKLLEEKQKQ
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atgactccccaaggcgtaaccatcaaccccgcctccacctctaacatggagccggccgcg
gccacagacaactcagtgccgaagctcgtagccaacggcctgagcagcacccatttctcc
atgtcgactagaccaggtctcagccccttctcctccaaggaagggtctggcactggaacc
ccgaccaccggcttccagaggcccccccttatcaataagcagctggagatggtgattcgc
accccggggcgtcagccgtcgcctcagccgacacatctgggtatccccggtggcacgcat
cgtgtgctgtccgaggaggggccggggtatgttgcggcgaagttcgaggggaagaagaag
cagatggaggctgttatggatgagcttgaggaaaagggattcatcccctcagagtttgtc
ccgtcagaaaccaattggttttacaacatgcttggcattgacgacatgtacttccagact
gagtcggtcgacgcgatcgtcagtcacatcctgtcactctatgctgccaaggttgcggca
tatgcccgggatgataagcgtctagagatacgattggacaaggaagctcctgatcatgcc
gtgtacatcgacactagcaagccagggatcagtgctttcgatggtcctcgctacgagcag
cgcatcgacgagaaatacatcaacggctgcacccctaaaaatgcgtatcgcgtcgaaacg
ttccgctctgctagttccttaccagataaccatgagcagcagcttcgttgctacttcgtc
tacaaatgtcacttcaacgagccccatccagacccggaagagaccaacattgaaattgtt
ggagagaagcgcttcttgcaaaaggccaccgcgaacacgaaggccatctaccaggaaatc
atcatcaatgctgttgcacgttcgggtcctgttatcgaaatgtttgaaattgaaggctct
cgcgagaagagactggttattgcttatcgccagggatccgctatgggcatgttcagcgcg
ctttctgatctctaccattactaccgcctgacaagctcacggaagtatctcgaaaacttc
tccaacggcatcactgtggtatccctctatctcaagccaatggcaggtgctgaaatctct
gggaaacatccacccatcgaagctgctattcaccaaatcatgaaggagatttctctgctc
tactgcatccctcaaaacaaatttcagggccactttgccagcggccttctcagcttacag
gagaccatctacgctcactgcgtctgggtgtttgtgcaacagttcctgaaccgcctggga
tccgaatatacatccctcaccgcaatcctcgactcgagcaatagctcccatgcagaactc
ctggcaaagatcaagaagagactccgtaccgaaactttcacgtcggactatatccttgaa
atcatcaacaagtatccccagctcatccacaagctttatcttgatttcgcacagacccat
tacgttcagatggtggagggtgtccccgatgacttcctgccaacgctgagttacctgcga
ttgcaagtcgatgaacccctggatcaagagggacttgacaagctcgtctccaagacagtc
gtcagcgagaatgacgagatggtcatgaactcattccgcatcttcaacaatgcagtcctc
aaaaccaacttctacacccctacgaaagttgccctgagcttccggctcgcagcagacttc
ctgccggaacacgagtatccccagcgcctgtatggaatgttcctggtcatcagctctgag
ttccgcggtttccacctgcgcttccgtgacatcgcgcgtggaggtatccgaatcgtgaag
agtcgtgacaaggaagcgtacgctatcaatgctcgatcgctcttcgacgaaaattacaac
ctggccaatacccagcagcgcaaaaataaggatatcccagaaggaggcgccaagggcgtc
atcttgctcgatgtcaatcaccagaataaagctagagttgcgtttgagaagtacatcgat
agtatcctcgaccttctcttaccaccggctagtcctggcatcaaagaccccattgtcgac
ttgcacggacaggatgaaatcctcttcatgggccccgatgagaatacggcagatctggtc
aactgggctacagagcatgctcgcaagcgcggtgcgccttggtggaagtccttcttcacg
ggcaagagtcccaagctgggtggtatcccccacgacagatatggcatgaccactctatct
gtccgccagtatgtgcttggcatctaccgcaagctagggatcgacccatcaaccgttcga
aagatgcaaaccggtggtccggacggtgacttgggctccaacgagatcctcttaggtaac
gagaaatactgcgctatcgttgatgggtccggagtcattgtcgatccgcagggtctagat
cacgatgaactagtcagactagcaaagaagcgcgccatgatcgttgaattcgacaaatcc
aagctgtcacctgagggttaccgtgttctcgtcgacgagagcaacgtcgttctacccagc
ggtgaggtggtgcacaacggcaccgtattccgcaatactttccacttgcgcgaggggcgg
tcgtttgacatgttcgttccctgcggcgggagaccagagtccatcgatcttagtaacgtg
tccagattgatcgagaatggcaagacgactatcccgtacatcgtcgagggtgccaacctc
ttcctgacacaggatagcaagctccgtctcgagaaagcggggtgcgtgatcttcaaagac
gcctccgtcaacaagggcggtgtcacctcttcttcgctcgaggtcctcgcttccctctcc
ttcgacgacaagggtttcgaagaaaacatgtgcgtgcgcgaggatgggaccattccgaat
ttctacgtcgagtatgtgcgcgaggtgcaggagattattcagcgcaatgcgcggttggag
tttgaggctatctggcgcgagcatgaggagacggggatgcctaggagcatgcttagtgac
aagcttagtatcgctattacaaagttggatgaggagttgcagaagacgcagttgtgggag
gatcgggagctgaggaaggctgtgcttagggatgcgttgcctaagctgcttttggaaaag
attgggttggagaccattttggagagggtccccatcagttacttgcgctccatcttcgga
agctaccttgccagccgcttcgtttacgagtacggcagcagcccgagccagttttcattc
ttcgatttcatgagcaagagatcagcgaaactcctagaggagaaacagaagcaatga

DBGET integrated database retrieval system