KEGG   Paracoccidioides brasiliensis Pb18: PADG_04116Help
Entry
PADG_04116        CDS       T03549                                 

Definition
(RefSeq) methionyl-tRNA synthetase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn00450  Selenocompound metabolism
pbn00970  Aminoacyl-tRNA biosynthesis
pbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PADG_04116
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PADG_04116
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pbn01007]
    PADG_04116
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pbn03016]
    PADG_04116
Enzymes [BR:pbn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PADG_04116
Amino acid related enzymes [BR:pbn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PADG_04116
Transfer RNA biogenesis [BR:pbn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PADG_04116
 Prokaryotic type
   Other AARSs
    PADG_04116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 22583305
NCBI-ProteinID: XP_010759324
UniProt: C1GA30
Position
Unknown
AA seq 573 aa AA seqDB search
MPEIELRAVSRAAWLIRSTGRRPLDLSAMQKRCCSERIAARNEQRSAGWRQEAILHYHTY
ILSPHVGHLYTMILGDVLKRWQILLGDTDAKLLTGTDEHGLKIQQAAAVAGMAPQELCDQ
NCQTFKNLARTVNVNYDHFIRTTDPQHKDAVRYFWDMLNHRGYIYTAKHEGWYSVSDEAF
YPPSAVQPILDPSTGRKIIASIETGKEVQWTSEENYHFRLSAFKEPLLEHYRNHPNFITP
KHYMDDMMNAISAGLQDLSISRPASRLNWGIPVPYDESQVIYVWLDALVNYITYAGYPFP
PDAKSIWPADVQVVGKDILRFHCIYWPAFLMALGLPLPRQIMAHAHWTINNEKMSKSTGN
VVNPYFAIERFGVDTVRFFLVIDGAQVSDSGYENSYIVERYKKGLQRGLGNLASRVLRGK
KWIVRSSVVMAGEGRFPRTEHQDFLESIPEKARDEMRQLDPRKALNSIMEIIIQTNKYFH
QMKPWILAMSNVVMLNSVIYSTAESLRIAGILLQPFMPQKSSELLDMLGVARAAEKRNFD
AAKFGRDLDYGVPLVDLKHGTTGTLFPPLISEQ
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaattgagcttcgcgctgtttccagagcagcatggcttatcaggtccacgggc
aggcgacctttggatctgtccgccatgcagaaacgctgttgttcggagagaatcgcggcg
cgcaatgagcagcgctccgcaggttggcgacaagaagccattctacattaccacacctat
attctatctccccatgtcggacatttgtataccatgatacttggggatgttctgaaacga
tggcagattctgttgggtgacacggatgcgaagctccttacagggacggatgaacatggt
ttgaagattcaacaggcggctgctgtggctgggatggccccccaggagctctgcgatcag
aactgccagacattcaagaatcttgccagaaccgtcaacgtgaactatgatcactttata
agaactacggatcctcagcataaggatgccgtacggtatttttgggatatgctcaaccat
cgcggctatatatatacagctaaacatgaaggctggtattccgtcagtgacgaggctttc
tatcctccgtccgctgtccagcctatccttgacccctcaactggccggaaaataattgcg
tccatagaaacagggaaagaagtgcaatggacgtccgaggagaattaccatttccggctc
tctgcttttaaggagccgctgcttgaacattacaggaaccatcccaacttcattacaccc
aagcactatatggatgacatgatgaacgctatctcggcaggattacaagatctatcgatt
tcacggcccgccagtcggctaaattgggggattccggtgccttacgacgagtcgcaggtt
atctatgtttggttggatgccctggttaactatatcacctatgccggatacccctttcct
cccgacgctaagtcgatatggccagcagacgtgcaggtggttggaaaggatattttacga
ttccactgcatttattggccggcgttcctgatggcattgggcctcccgctgcctcgccaa
atcatggcgcacgctcattggacgatcaacaatgagaagatgtccaagtcgacgggcaac
gtcgtcaacccatactttgccattgagcgttttggcgttgatacggtgcgcttctttctc
gtcatcgatggcgcccaggtttccgattccggttacgaaaactcatatatcgtcgagagg
tacaagaagggcctgcaacggggccttgggaatcttgctagccgtgtgctgcggggtaag
aagtggattgtgcggagtagtgttgtcatggccggggaagggcggtttccgaggacggag
catcaggatttcctcgagtcgatcccggagaaggccagggatgagatgaggcagctggac
ccacgtaaggcgctgaacagcatcatggaaatcataattcagaccaacaaatatttccac
caaatgaaaccttggatcctggccatgtccaacgtcgtcatgctgaacagtgtcatctac
agcaccgccgagtctctccgcattgcaggcatactcctgcagccattcatgccccagaaa
tcctcagagctgctggacatgctaggagttgcaagggcggccgaaaaacgcaatttcgac
gccgccaagttcggcagggatctggattacggcgtcccccttgtggatcttaagcatggc
acgaccggtacgttgttcccgccgctgataagcgagcagtga

DBGET integrated database retrieval system