KEGG   Paracoccidioides brasiliensis Pb18: PADG_05414Help
Entry
PADG_05414        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    PADG_05414
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pbn03041]
    PADG_05414
Enzymes [BR:pbn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     PADG_05414
Spliceosome [BR:pbn03041]
 Complex C
  Other components
   Step II factors
    PADG_05414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 T2SSE AAA_30 AAA_19 AAA_33 AAA_16
Motif
Other DBs
NCBI-GeneID: 22584349
NCBI-ProteinID: XP_010760995
UniProt: C1GDS8
Position
Unknown
AA seq 1224 aa AA seqDB search
MDDLESLELFSLVSKVTTELQNHLGVNDKTLAEFVIDQHLKCNSFAKFKSALDDIGAEFP
QSLIESIDRLVLTLHPKFKDKQKESSKAAQQNGDDEVLDGIERKARVFKGLAVPDKVPQW
GDDDARAEPTSTDDANAGAMDDTFAMLEGLAGKARERKSTTKNRKRSRSPDGDEYDGRRP
RKDRYRSRSRSRSAERSHRRRDNLDEFGRSVPKHRGRDDKYNNGYSGRKRRSDRDDEEFF
RRPPTPELDDQPILFKIYDGRVTGLKDFGAFVNLQGVRGKVDGLVHVSAMQDGARVNHPS
DLVSKGQPVKVKVISIQGSRIGLSMKEVDQVTGRDLVPQKRIASGANMERLNGTGADDRY
GNLSSSVPVIEGDDGKPMKNRKRLNSPERWEIKQLIASGAVSAADYPDIDEEYHATLNGE
GEFEEEEDVDIEVRDEEPPFLAGQTKQSLELSPIRVVKAPDGSLNRAAMAGTNLAKERRE
LRQQEAQDRAAEQAAKVDLNAQWQDPMVAPEQRKFAADLRNAQVTKTTDSMPEWKRVTQS
KDQSFGKRTNMTMKQQRESLPVFKFRKQLLEAVRENQLLIVVGDTGSGKTTQLTQYLAEG
GFANDGIIGCTQPRRVAAVSVAKRVSEEVGCRLGAEVGYTIRFEDCTSPETKIKYMTDGI
LQREILLDPDLKKYSVIMLDEAHERTISTDVLFGLLKKTLKRRHDLKVIVTSATLDADRF
SEYFNMCPIFSIPGRTYPVEIMYSREPESDYLDAALVTVMQIHLTEPAGDILLFLTGQEE
IDTACEILYERMKALGPSVPELIILPVYSALPSEMQSRIFDPAPPGSRKVVIATNIAETS
ITIDQIYYVVDPGFVKQNAYDPKLGMDSLVVTPISQAQAKQRSGRAGRTGPGKCFRLYTE
AAYQSEMLPTTIPEIQRQNLSHTILMLKAMGINDLLHFDFMDPPPTNTMLTALEELYALS
ALDDEGLLTRLGRKMADFPMEPALAKVLIASVDMGCSDEMLSIVAMLSVQSVFYRPKEKQ
QQADQKKAKFHDPHGDHLTLLNVYNAWKNSRFSNPWCFENFIQARQMRRAQDVREQLVTI
MERYKHKIVSCGRNTTKIRQALCSGFFRNAARKDPQEGYKTLIEGTPVYMHPSSALFGKA
AEHVIFHTLVLTTKEYMHCTTSIEPKWLVEAAPTFFKVAPTDRLSKRKKAERIQPLHNRF
AGDDDWRLSSQRRQGRGGGGGTWG
NT seq 3675 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcttgagtcgttggagctcttttccctcgtatccaaagtaacaactgagctc
caaaaccatctcggagtgaacgacaaaacactcgccgaattcgtgatcgaccagcattta
aaatgcaactcctttgcaaagttcaagagtgctctcgatgatataggcgcggaatttcct
cagagtttgattgagagtatagatcgcctggtactgacgttacacccgaagttcaaggat
aagcagaaggagtcctcaaaggccgcccagcagaatggcgacgatgaagtcttggacggg
attgaaaggaaagcgcgcgtttttaaaggtctagcggtgccggacaaggtgccacaatgg
ggggacgatgatgcaagggcggaacctacgtcgacggacgatgcgaatgcgggagctatg
gatgatacctttgcgatgttggagggtttagcgggaaaggcaagggaacgaaagagcacg
acgaagaataggaaaagaagtagaagcccggatggtgatgaatatgacggcagaagacca
cgaaaggacagatatcgatctagatcaaggtcgcggagcgcagaaagatcacaccgaaga
cgtgataacctggacgagttcggcagatccgtcccaaaacacaggggcagagatgacaag
tacaacaatggctatagtggaagaaagaggcggagtgatcgcgatgatgaagaattcttc
agaaggcctccgacgcctgagcttgacgatcagccaatacttttcaaaatttacgacggg
agggttacggggttaaaagactttggagcatttgtgaaccttcagggcgtcagggggaag
gttgatgggctagttcacgtctccgcgatgcaagacggtgcacgagtcaaccatccctcg
gaccttgtctcgaagggccaaccggtgaaagttaaagtcatctctatacaaggcagtcga
ataggtttatctatgaaggaagttgatcaagttactggccgtgatctcgttccccaaaag
cgaattgcttccggtgcaaatatggaacgacttaatgggactggcgcagatgaccgctac
gggaatctgagttcctcagttcccgtcattgaaggtgatgatggcaagcccatgaaaaac
cgaaaacgcttaaattctcctgaaagatgggaaatcaagcaactcattgcatcgggtgct
gtatctgctgctgattatccggatatcgatgaagaatatcatgctactttgaacggggaa
ggagagtttgaggaggaggaggatgtggatattgaagtcagagatgaagagcctccgttc
ttggctggtcaaacaaaacaatctcttgaactctctcctattcgtgttgttaaggctcca
gacggctcactgaatcgtgctgcaatggctggaacaaatttggcaaaggaaagaagagag
ttacgacagcaagaggctcaagatagggctgctgagcaggctgcaaaagtggatctcaac
gcccaatggcaagaccccatggtcgcgcctgaacagaggaaatttgctgctgacttgcga
aatgcgcaagtaacgaaaacaaccgattctatgcctgaatggaaacgggtgacccagagc
aaggaccagtcattcgggaaaaggacaaatatgacaatgaagcagcaacgtgaaagtctt
cctgtttttaaattccgcaaacagttactggaagctgttcgggaaaaccaacttctcatc
gttgtcggagacacaggttccggtaaaactacccagctaacacagtatcttgctgaaggc
gggtttgcaaatgacgggatcattggttgtacccaaccccgacgtgtggctgctgtctct
gtagcaaaacgtgtgtctgaagaagttggctgtcgtttaggtgcagaagtcggttacacc
attcgatttgaagactgtactagtcctgaaacgaagatcaaatacatgacggacggtatc
cttcagagagaaattcttcttgatccagacttgaaaaaatattcagttatcatgcttgat
gaggctcacgaacggaccatcagtactgacgtattgtttggccttctcaaaaagacgctt
aaacggcgacatgatcttaaggtcatcgttacctcagccactctagatgccgatagattc
tcggaatatttcaacatgtgccccatcttctcaattcctggacgaacataccctgtggaa
ataatgtactcgagagaaccagaatccgattatttggatgcagcgttagtcacagtgatg
cagatacatttaacggaaccagctggggatattctattgttcttgactggtcaagaagaa
atcgataccgcctgcgagattctgtatgaacgaatgaaagcgcttggacccagtgtccct
gagctaatcattttgcccgtctattctgctctgcccagtgagatgcaaagtaggattttt
gaccctgctcccccgggaagccgaaaggttgttatcgctacgaacattgcagaaacgtca
attacaattgatcaaatctactacgtagtcgacccgggatttgttaaacaaaatgcctat
gatccaaaacttgggatggattcacttgtggttacgcccatatcacaagcacaggccaag
cagcgttcgggacgtgcaggaagaacgggcccaggtaaatgcttccgtctttacactgaa
gccgcctaccaatcagaaatgcttccaaccactatccccgaaatccaacgccagaatctc
tctcatacaatcctcatgctaaaagctatgggcatcaacgaccttctccactttgatttc
atggacccacccccaacaaacaccatgcttacagcacttgaggagctctatgccctctct
gccctagacgatgaaggtctcctgactcgactgggacgaaaaatggccgatttccccatg
gaaccggctttagcaaaagtcctaatcgcctctgttgacatgggctgttctgatgaaatg
cttagcatcgtcgccatgctttcagtccaaagtgtattctatcgacccaaggaaaagcag
caacaagcagatcaaaagaaggccaaattccacgacccgcacggcgaccacctcacactc
ttaaacgtctataacgcttggaaaaattcacgcttcagcaacccctggtgttttgagaac
ttcatacaggcacgccagatgcggcgggcacaggatgtgcgtgagcagttggtaactatc
atggagcgctacaaacataaaatcgtttcttgcggacgtaacacaaccaagattcgacag
gcgttgtgctcaggattcttcaggaatgccgcacgcaaggatccgcaagaagggtataaa
acgttgatcgaaggaacacctgtttacatgcaccccagctctgcgctatttgggaaggca
gcggagcacgttatattccatactctggttcttacgacaaaagaatacatgcattgcact
acaagcattgaaccaaaatggctcgtcgaagcagctccaacattcttcaaagtcgctcca
actgaccggctctcaaaacgaaagaaggcagagcggatccaacccctccacaaccgattt
gcaggcgacgacgactggcgattatcatcgcaacgacgacaaggcagaggtggtggaggc
ggaacttggggatga

DBGET integrated database retrieval system