KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_06950Help
Entry
PACID_06950       CDS       T02345                                 

Definition
(GenBank) Propionyl-CoA:succinate coenzyme A transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Pathway
pbo00020  Citrate cycle (TCA cycle)
pbo00620  Pyruvate metabolism
pbo00650  Butanoate metabolism
pbo01100  Metabolic pathways
pbo01110  Biosynthesis of secondary metabolites
pbo01120  Microbial metabolism in diverse environments
pbo01130  Biosynthesis of antibiotics
pbo01200  Carbon metabolism
Module
pbo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PACID_06950
   00620 Pyruvate metabolism
    PACID_06950
   00650 Butanoate metabolism
    PACID_06950
Enzymes [BR:pbo01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     PACID_06950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans CitF
Motif
Other DBs
NCBI-ProteinID: AFV88533
UniProt: K7RUC5
Position
complement(787102..788613)
Genome map
AA seq 503 aa AA seqDB search
MSDRIANEALRQKVMSADDAASLIHDGDQIGFGGFTGSGYPKEFPPALAKRITAAHEKGE
HFTVNAFTGASTAPELDGVLAGVDGIGMRSPYQSDPTMRAKINDGTSFYTDIHLSQFGMQ
VREGFFGKLDYAVIEATKITADGNAIPTSSVGNNAVYVEKAEKIIIEVNDWQSEDLEGMH
DIYYGFALPPNRVPIPITHPGDRIGETFLRVPQNKVVAIIETHDPDRNSPFKPIDEDSHK
IAGYLLDFYANEVEHGRMPKNLLPLQSGVGNIPNAVLDGLLHSDLDHLTSYTEVIQDGMI
DLIDAGKVDVASATAFSLSPDYAHKMNENAAFYRNHIILRPQEISNHPEVIRRLGVLGAN
GMIEADIYGNVNSTHVMGSRMMNGIGGSGDFTRNAFISAFVSPSTAKGGKISAIVPMVSH
VDHTEHDTMVIITEQGIADLRGLAPRQRAPKIIDNCAHPDYRDALHDYYDRALRDCKFKQ
TPHLLEESYSFHRRFQETGSMKA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatcggattgccaacgaggctctgcgtcagaaggtgatgagtgccgatgacgcg
gcttccctcatccatgacggcgaccagatcggcttcggtgggttcaccgggtcgggctac
cccaaggagttcccgccggcccttgccaagcgcatcacggccgcccacgagaagggcgag
cacttcaccgtcaacgccttcaccggcgcctccaccgcccctgagctcgacggggtcctg
gccggggtggacggcatcgggatgcgctccccgtaccagtcggaccccacgatgcgggcc
aagatcaacgacggcacgagcttctacaccgacatccacctgtcgcagttcggcatgcag
gtccgtgagggattcttcggcaagctggactacgccgtgatcgaggccaccaagatcacc
gccgacggcaacgccatccccacctcctcggtcggcaacaatgccgtctacgtcgagaag
gccgagaagatcatcatcgaggtcaacgactggcagtccgaggacctcgagggcatgcac
gacatctactacggattcgcgctgccgccgaaccgcgtcccgatcccgatcacccatccc
ggtgaccggatcggcgagaccttcctgcgggtgccgcagaacaaggtcgtcgcgatcatc
gagacccacgatcccgaccgcaactcgcccttcaagccgatcgacgaggactcccacaag
atcgccggctacctgctggacttctacgccaatgaggtcgagcacggccggatgccgaag
aacctgctgcccctgcagtcgggcgtcggcaatatcccgaacgccgtcctcgacgggctg
ctgcactcggatctggatcacctcacctcctacaccgaggtgatccaggacgggatgatc
gatctcatcgacgccggcaaggtcgacgtggcctcggccacggccttctcgctgtctccc
gactatgcccacaagatgaatgagaacgcggccttctaccgcaaccacatcatcctgcgc
ccccaggagatctcgaaccatcccgaggtgatccgccgtctcggcgtgctgggcgccaac
ggcatgatcgaggccgacatctacggcaacgtgaactccacccacgtgatgggctcgcgg
atgatgaacggcatcggcgggtcgggagacttcacccgcaacgccttcatctcggccttc
gtgtccccctcgaccgccaagggcggcaagatctcggcgatcgtgccgatggtctcccac
gtcgaccacaccgagcacgacacgatggtcatcatcaccgagcagggcatcgccgatctg
cgtggcctggccccccgccagcgcgccccgaagatcatcgacaactgcgctcacccggac
taccgggatgcgctgcacgactactacgaccgggccctgcgcgactgcaagttcaagcag
accccgcacctgctcgaggagtcctactccttccaccgcaggttccaggagaccggctcc
atgaaggcctga

DBGET integrated database retrieval system