KEGG   Sedimentisphaera salicampi: STSP1_00692Help
Entry
STSP1_00692       CDS       T05439                                 

Definition
(GenBank) Beta-hexosaminidase A precursor
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pbp  Sedimentisphaera salicampi
Pathway
pbp00520  Amino sugar and nucleotide sugar metabolism
pbp01100  Metabolic pathways
pbp01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pbp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    STSP1_00692
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    STSP1_00692
Enzymes [BR:pbp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     STSP1_00692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ARN56316
UniProt: A0A1W6LKN4
Position
complement(939966..941081)
Genome map
AA seq 371 aa AA seqDB search
MKRNPAAIILIMLMFSACGFCAEDQNKPSIREMAGQMLMAGFRGLMPEQCPQILEDIEKR
NLGGVILFDYDVSLDKPVRNIESPAQLKRLVSALKSRAKAPLLVAVDQEGGQVCRLKEKF
GFPETNSAEHLGNIDDPEKTRLAGRQIGQTLANIGINLNLAPCVDVNINPDNPAIGRLER
SFSPNPRKTAVHGRAFAQGLSEADVLSCIKHFPGHGSAYNDSHKGLTDITNTWLPKELIP
FRSIIRSGDADMVMTAHLVNENIDPKYPATLSKNFLYTMLRLGIGWDGVVITDDMQMKAI
AEEYSLKRSIKLSINAGADILLFANNLSWQPDIVEKALEMIEGLLLEGKIKRARIRESYE
RIMKLKEKLKK
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaacccagcagcaattattctaataatgctaatgttttcggcctgtgggttt
tgtgctgaagaccaaaataaaccaagtattcgtgagatggccggccagatgctgatggct
ggcttccgtgggctcatgcctgaacaatgcccccaaatacttgaagatattgagaaacgc
aatcttggcggcgttatactgtttgattatgacgtatcgctggataagcccgtacgcaat
attgaaagcccagcacagctcaaaagacttgtttctgcccttaaatcccgtgctaaagca
cctcttcttgtagcagtggatcaggagggcgggcaggtttgcaggctcaaggagaaattc
ggcttcccggaaacaaactctgccgagcatctgggcaatatagatgatcctgaaaaaaca
aggctcgccggaaggcaaattggccaaacgcttgctaatatcggcatcaatctcaatcta
gccccctgtgttgacgttaatatcaatccggacaacccagctattggcaggctcgaacgc
agcttctcgcccaatccccgcaaaacagccgttcacggcagggcattcgcccagggactc
agtgaggccgatgtattaagctgcataaagcacttccccggtcacggcagcgcatacaac
gattcccacaagggacttaccgatataacgaacacttggctgcccaaagagcttataccg
tttcgcagtattatccgctccggcgatgctgatatggttatgacagcccatttggtaaat
gaaaacattgatcccaaataccccgcaacgctctccaaaaactttctgtacacaatgctt
cgcctcgggatcggctgggatggagttgtgataaccgatgatatgcagatgaaagcgatt
gcagaagagtattcactcaaaaggagcattaagctttcgataaatgcaggtgctgatatc
ctgctctttgcaaacaacctctcatggcagcctgatatcgtagaaaaagccttggaaatg
attgaaggcttactattagagggcaagattaaacgggccagaataagagaaagctatgag
cgtattatgaagctcaaagaaaaactaaaaaaatga

DBGET integrated database retrieval system