KEGG   Sedimentisphaera salicampi: STSP1_01489Help
Entry
STSP1_01489       CDS       T05439                                 

Gene name
sglT_12
Definition
(GenBank) Na(+)/glucose symporter
  KO
K03307  solute:Na+ symporter, SSS family
Organism
pbp  Sedimentisphaera salicampi
Brite
KEGG Orthology (KO) [BR:pbp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    STSP1_01489 (sglT_12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF DUF5134
Motif
Other DBs
NCBI-ProteinID: ARN57094
UniProt: A0A1W6LMW7
Position
complement(1992017..1993603)
Genome map
AA seq 528 aa AA seqDB search
MKVETYFTGADWVILALYFVLTMGIGFYFYRKSRSVEGFTAASRALPGWACGLSIFATYL
SSISFLGLPGKSFGGNWNPFVFSLSIPVATWIAVKFFLPYYRRTGEVSAYAHLEHRFGTW
ARMYASFFYVLTQLARMGVVMYLMALPLSVLLGKDIRLIILVTGLSVTVYSFVGGIAAII
WADALQAIVLMVGAVACSAIMLFNMPEGPAQVFEIAAANDKFSLGSFGPSLTNATFWVVL
VYGVVINLQNFGIDQSYIQRYIASKNTKEARKSIWLGGLLYLPVSAVFFFIGTQLYAYYQ
THPEYMQEVRYTVAEQQLLRENVSESDAGFREMLDERAESVTISEMGDKVFPHFIGKQLP
VGVTGLLIAAIFAAAMSTVSTSLNSSATLIATDWYQRFINKKSTEKQSMLAIYTATILWG
LLGTGTALLLVNITSALDAWWTLAGIFGGGMLGLFLLGLISRRANSPIAAASVIMGLIVI
AYMTLSPKIGALPDHLKSHLHSFLIPVFGTMVILVSGLLISRFVKRKA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgaaacgtatttcaccggcgcagactgggtgattctcgctctctattttgtg
ctcactatgggaatcggtttctacttctaccgaaaaagcagatcggtggagggttttaca
gcagcaagcagagctctgcccggctgggcttgcggactttcaatattcgccacctacttg
agcagcataagttttctcgggctcccgggcaaatcgttcggcggaaactggaacccgttt
gtattcagcctttcgattcctgtggcaacgtggattgctgtgaagtttttcctgccctac
tacagaaggacgggggaagtctcagcgtatgcgcaccttgaacaccgattcggaacgtgg
gcgaggatgtacgcaagcttcttctacgtgcttactcagcttgcacgtatgggggttgtg
atgtatctgatggctttgcctctgagcgtgcttcttggtaaagatataaggcttatcatc
cttgttacaggtctctctgttacggtttattcattcgttggcggtattgcagcgattatc
tgggcagatgcgcttcaggctattgttctgatggttggtgcggttgcctgctcggccata
atgctttttaatatgcccgaaggtcctgcacaggtatttgagatagctgcggctaatgat
aaattcagcctcggaagcttcgggccatcgctcaccaacgcaactttctgggttgtactg
gtttatggagtggtgataaatcttcagaatttcggtatagaccaaagctatatccagcgc
tacatcgcctctaaaaacacgaaagaagcgagaaaaagcatctggctcggcggccttctt
tatctgccggtatcagcggtattcttcttcataggaactcagctttatgcctactatcaa
actcaccctgagtatatgcaggaagttagatatactgtagcagagcagcagcttttaaga
gaaaacgtctctgagagcgacgcagggtttagagagatgcttgatgaaagggctgagtct
gttactatttctgaaatgggagacaaggtatttccgcacttcatcggcaaacagctcccc
gtaggcgtaacggggcttttgattgccgctatatttgcagcagcgatgagtactgtatca
acgagtttgaactcctctgcaacattgatcgcaacggactggtatcagcgatttatcaat
aaaaaatccaccgagaagcagtctatgcttgccatctacaccgcaacaatcctctgggga
ctcttgggaactggaacagcgcttctgctggtgaacataaccagcgcgcttgatgcgtgg
tggacgctggcaggtatattcggaggcggtatgctcgggctcttcctgctcgggctgata
agcagaagggcaaacagcccaatcgctgctgcgtcagtgataatggggctgatagttata
gcatatatgacattatcaccaaagattggagcgcttccggatcacctgaaaagccatctg
cattccttccttattcccgtattcggaacgatggtaatacttgtatcagggctgctgata
agcagatttgtaaaaagaaaggcttaa

DBGET integrated database retrieval system