KEGG   Peptostreptococcaceae bacterium oral taxon 929: C3V37_04215Help
Entry
C3V37_04215       CDS       T05383                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pbq  Peptostreptococcaceae bacterium oral taxon 929
Pathway
pbq00480  Glutathione metabolism
pbq00590  Arachidonic acid metabolism
pbq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    C3V37_04215
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C3V37_04215
Enzymes [BR:pbq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     C3V37_04215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AVM67081
UniProt: A0A2P1G463
Position
complement(816936..817406)
Genome map
AA seq 156 aa AA seqDB search
MFYDYKVKNISGEDVSMSEYKDKVVLIVNTASKCGFTKQYEGLEELYKKYKDQGFVILGF
PCNQFGSQEPGGNEEIKNFCTSTFSVTFPMMSKIDVNGDDANPLYKFLKKEKGGILGDDI
KWNFTKFLIDREGNVVDRFASQKTPKALEKEVEKLL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgttttacgattataaagttaagaatatatcaggtgaagatgtatccatgtcagaatac
aaggacaaagtggtacttatagttaacacagccagcaagtgcggttttactaagcaatac
gaaggtcttgaagaactctacaaaaagtataaggaccaaggttttgtcatcttaggcttt
ccatgcaaccaatttggatcgcaggagccaggcggcaatgaagagataaaaaacttctgc
acttctacattcagtgtgacttttcctatgatgtcaaaaattgatgtcaatggcgatgac
gctaatccattatacaaatttttgaaaaaagaaaagggcggcatcttaggcgacgatatc
aaatggaatttcacaaagtttttgatagatagagaaggaaacgttgtagatagatttgct
tcacaaaagacaccaaaggcactagaaaaagaagtagaaaaactattgtag

DBGET integrated database retrieval system