KEGG   Parvularcula bermudensis: PB2503_00642
Entry
PB2503_00642      CDS       T01298                                 
Name
(GenBank) TraH
  KO
K12072  conjugative transfer pilus assembly protein TraH
Organism
pbr  Parvularcula bermudensis
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pbr02044]
    PB2503_00642
Secretion system [BR:pbr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PB2503_00642
SSDB
Motif
Pfam: TraH PTS-HPr
Other DBs
NCBI-ProteinID: ADM08209
UniProt: E0TB00
Position
complement(31524..32942)
AA seq 472 aa
MRRFLKLPAAVASFVYGLSMPTSAAADVNAEMNQFWNDLGVAANVTGPSSFEGQRAGYYT
FGNVYVRTPQRSLSPVNIQMPGYRAGCGGIDIYGGGFSYVNSAELVAFMKSVANNAASFA
FQVALETISPVIAEKVGELQSVAQRINQMAINSCESGQLAVAAVWPQSDQASRVICEASA
SRRGLYPDWVAARHGCGSEGERSNVLAGASVEEKASIPQNINIAWDALKKHPVISGDREL
MQFLMTLSGTEILTAGADDDAAQSYQFLPSKMLDPGVISAFLDGGTIDIYECETDPDDLC
LAPTTGGSVTIASSDGLRARVSQMLADIMGKVRTRTALTADEQAFLNVTSLPVYKMINVH
AAYEGVFADQTIQSYAEIIAIDLLYGLFEGYAEMLSEAGSTATSGARDSVVAWKEQLTRQ
REFLLQYQLENNARVEVIEQVIARTQAIERQLAGRLSKDLADAYQFSRNASY
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgcgccgtttcctgaaactgcccgctgctgtcgcttctttcgtgtacggcctctcgatg
cccacaagcgccgccgccgacgtcaatgctgagatgaaccagttctggaacgatctcggc
gtcgcggccaatgtcaccggtccgtcgagcttcgaaggccagcgggcaggctactacacc
ttcggcaatgtctatgtgcggacgccgcagcggagcctgtcaccggtcaacatccagatg
cccggctaccgggcggggtgcggcggcatcgacatctatggcggcggcttctcctatgtg
aactccgccgaactcgtcgccttcatgaagtcggtcgcgaacaatgcggcgagcttcgcc
ttccaggtggcgctcgaaaccatcagccccgtcatcgcggagaaggtgggcgagcttcag
tccgtcgcccaacggatcaatcagatggcgatcaattcctgtgagagcggtcagctggcc
gtcgcggctgtctggccccaatcggatcaggcgagccgtgtcatctgcgaggcgtcagcg
tcccgtcgcggcctctatcccgactgggtcgccgctcgccatgggtgcggctcggaaggc
gagcggtcgaatgtgctggccggcgcgagcgtcgaggaaaaggcgtcgatcccccagaac
atcaacatcgcctgggatgcactgaagaagcaccccgtgatctccggcgaccgggaactg
atgcagttcctgatgaccctgtcgggcacggagatcctgaccgctggcgccgatgacgac
gcggcgcaaagctatcagttcttgccgtccaaaatgctcgatccgggggtcatctccgct
ttcctcgatggcggcaccatcgatatctatgaatgcgaaacggacccggacgatctctgt
ctcgcgccgacgaccggcggcagtgtgaccatcgcttcaagtgacggacttagagcccgg
gtcagccagatgctggccgacatcatgggcaaggtccggacccggacggccctcacggcg
gatgagcaggcctttctcaatgtgacgagcctgccggtctacaagatgatcaacgtccat
gccgcctatgaaggcgtcttcgccgatcagaccattcagtcctatgcggagatcatcgct
atcgatctcctctacggcctcttcgaaggctatgccgaaatgctcagcgaggcgggctcg
acggcgacgtcgggcgccagggacagcgtggtcgcctggaaggagcagctgacccgccag
cgcgaattcctgctccagtatcagctcgagaacaatgcgcgcgtcgaggtcatcgaacag
gtgatcgccagaacccaggcgatcgagcgtcagctcgccgggcggctctccaaggatctc
gctgacgcgtatcagttctcgcggaacgcgagctattag

DBGET integrated database retrieval system