KEGG   Parvularcula bermudensis: PB2503_00662
Entry
PB2503_00662      CDS       T01298                                 
Name
(GenBank) hypothetical protein
  KO
K12059  conjugal transfer pilus assembly protein TrbC
Organism
pbr  Parvularcula bermudensis
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pbr02044]
    PB2503_00662
Secretion system [BR:pbr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PB2503_00662
SSDB
Motif
Pfam: TrbC_Ftype Host_attach DUF2229 Cuticle_3
Other DBs
NCBI-ProteinID: ADM08213
UniProt: E0TB04
Position
complement(35806..36531)
AA seq 241 aa
MAILCASLMSVAPGQAQDGIDRKAIEEAVRNAEAEAAAFAAEVAARAEAYAEEARALTET
VHGRWGEAAAPSDTTEPVDLDAMVADAGVVSAARQETSGPAGVLVFVSFSMPEQSLRQLV
LDAHKAQVPVLLQGFVGGSLKETATRMRALLGADTGQDLLGGVVIDPRAFRIFRVTEVPA
FIATRAPLPDCDGLDCDAPPPPHDRIAGNMSLGAALSALASEGTDAALQARASLKRWEAQ
P
NT seq 726 nt   +upstreamnt  +downstreamnt
atggccatcctctgcgcctcgctgatgtccgtggctccgggtcaggcgcaggatgggatc
gatcggaaggcgatcgaggaggcagttcgcaacgctgaagccgaagcggcggccttcgcc
gctgaagtcgccgctcgggccgaggcctatgccgaggaggcgagggcgctcaccgagacc
gtccacggacgatggggcgaggcggctgcgcccagtgacacgacagagccggtagacctc
gacgcaatggtggccgatgccggtgtggtcagtgccgcgcggcaggagacgtcaggccct
gctggcgtcctcgttttcgtcagtttttcgatgcccgagcaaagtctccgccagctggtg
ctcgacgcgcacaaggcccaggtgccggtgctgcttcagggcttcgtgggcggctccctc
aaggagaccgccacccgcatgcgagcactgctcggggccgacacaggacaggatcttctc
ggcggggttgtgatcgatccgcgggccttccggatcttccgggtgaccgaagtcccggcc
ttcatcgcgacgagggcgccactccccgactgcgatggtctcgactgcgacgcgcctccg
ccgccccatgaccggatcgccggcaacatgtcactgggcgcggccctgtcggcgctcgca
tccgagggcaccgacgcggcgcttcaggcgcgtgcttccctaaagcgatgggaggcacag
ccatga

DBGET integrated database retrieval system