KEGG   Parvularcula bermudensis: PB2503_00667
Entry
PB2503_00667      CDS       T01298                                 
Name
(GenBank) putative conjugative transfer protein TraU
  KO
K12060  conjugal transfer pilus assembly protein TraU
Organism
pbr  Parvularcula bermudensis
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pbr02044]
    PB2503_00667
Secretion system [BR:pbr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PB2503_00667
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: ADM08214
UniProt: E0TB05
Position
complement(36542..37543)
AA seq 333 aa
MRRPALILAAIAYLMTPPARADAPTCGGTFVNPITDICWSCLFPISLGAAPIWPSSRPDT
ANPPSPICTCPIPLPPFVRIGLSIGYWEPVRLMDVTKKPYCFANLGGTRIDLGLSIGAKS
SGQSDNEDDVGSWHVHYYMYPLIYWLELLTDFGCMQTADFDLLYLTEIDPLWNNDELTFL
LNPEAVVFANPIAQAACAADCVAASAHLPVDQLFWCAGCHGSMYPMDGNIAAEYGHVQGA
SLAAERFLYKLHRQGIGWQHSGSGHVCQNWPNPMIKKSEYRLQLVNPVPNVAGRWACPTL
GASNVLYEIGRTIPVIGEDYGFLVWQKENCCVF
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgagacggccggctctgatcctcgctgcgatcgcgtaccttatgacgcctccggcgcgc
gccgatgctcccacctgcggcggcaccttcgtcaatccgatcacggatatctgctggtcg
tgtcttttcccgatctccctcggtgcggcgccgatctggccgtcctcgcggcccgacacg
gccaatccgccgagccccatctgcacctgtccgatcccgttgccgccctttgtccggatc
gggctttccatcggctattgggagcccgtccgactgatggacgtcaccaaaaagccctat
tgcttcgccaatctcggcggcacacggatcgaccttggcctctccatcggtgcgaagtcc
tcaggtcagtccgacaatgaggacgatgtcggctcctggcacgtccattactacatgtat
ccgttgatctattggctcgagctcctgaccgatttcgggtgcatgcagacggccgatttc
gatcttctctatctgaccgagatcgatcccctctggaacaatgacgagctgacctttctc
ctcaaccccgaagcggtcgtcttcgccaacccgatcgctcaggcggcctgcgccgccgac
tgtgtcgccgcgtcagcccatctgccggtggaccagctcttctggtgcgcggggtgccat
ggctcgatgtaccccatggatggcaacatcgccgcagaatacggccatgtccaaggggcg
agcctcgcggccgaacggtttctctacaagctccatcgccaggggatcggctggcagcat
tcgggctccggccatgtctgccagaactggccgaacccgatgatcaagaagtccgaatac
agacttcagctggtcaatcctgtgccgaacgtcgccgggcggtgggcctgccccaccctg
ggcgcctccaacgtcctctacgagatcggcaggaccatcccggtgatcggagaggattac
ggctttctcgtctggcagaaggagaattgctgtgtcttctga

DBGET integrated database retrieval system