KEGG   Parvularcula bermudensis: PB2503_00697
Entry
PB2503_00697      CDS       T01298                                 
Name
(GenBank) hypothetical protein
  KO
K12064  conjugal transfer pilus assembly protein TraV
Organism
pbr  Parvularcula bermudensis
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pbr02044]
    PB2503_00697
Secretion system [BR:pbr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PB2503_00697
SSDB
Motif
Pfam: TraV
Other DBs
NCBI-ProteinID: ADM08220
UniProt: E0TB11
Position
complement(41998..42459)
AA seq 153 aa
MTRALIIPLFALAVTGCSSTMRLENVAGTWSCPRVDGVCADIAAIDRSVVGETGPLPIRG
PATPSSPLVTVGLEEDGMALTRTGDEVARIVLAPMIDAHGHYHASRVIYAVMSTGGWART
PVARPEATSIAATAPLPTEPRTRLASEGGDRDD
NT seq 462 nt   +upstreamnt  +downstreamnt
atgacccgtgccctgatcatcccgcttttcgctctcgctgtgacaggctgttccagcacc
atgcgcctcgagaatgttgccggcacgtggagctgtccgcgggtcgatggcgtctgcgcc
gacattgccgcgatcgaccgcagcgtagttggcgagaccgggccgttgccgatccgtggc
cccgccacaccgtcctcacccctcgtcaccgtcggcctggaagaggacggcatggccctg
acccgcaccggggatgaggtggcgcggatcgtcctggcgccgatgatcgacgcccatggc
cactatcatgcgagccgtgtgatctatgccgtcatgagcacggggggatgggcgcgcacg
ccggtcgccaggccggaggccacctccattgctgcgaccgcgccgctgccgacggagccg
cgcacgcggctcgcctccgaaggaggggatcgtgacgactga

DBGET integrated database retrieval system