KEGG   Parvularcula bermudensis: PB2503_00712
Entry
PB2503_00712      CDS       T01298                                 
Name
(GenBank) hypothetical protein
  KO
K12066  conjugal transfer pilus assembly protein TraK
Organism
pbr  Parvularcula bermudensis
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pbr02044]
    PB2503_00712
Secretion system [BR:pbr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PB2503_00712
SSDB
Motif
Pfam: TraK
Other DBs
NCBI-ProteinID: ADM08223
UniProt: E0TB14
Position
complement(44697..45428)
AA seq 243 aa
MIRTLLISAASAACLSAAAHAQQIVEASDGGVVTGYVSASGITRLRFTSDAAASVQMAEG
GEGAGFSIQHEPATGDLYLTLGRLPRQGEAVGAASFFVTTRAGYTYQVELAAKATPSTQI
EVRNPDLARRQTERALAETSLDEEVVALTRAMWASALLDGYEIKRPVVRERAAGTLRLAV
RATYESDALQGRVLIARNPSRGDVAIEESLFLAPGVAAVTIQGPRVLGPGASVPVLIVDR
GQP
NT seq 732 nt   +upstreamnt  +downstreamnt
atgattcggaccctccttatctccgccgccagtgcggcctgtcttagcgcggcggcccat
gcccaacaaatcgtcgaagcctccgatggcggtgtcgtcaccggctatgtgagcgccagt
gggatcacgcggctgcgctttacgagcgatgccgcggcgtcggtccagatggccgaaggc
ggagagggggccgggttctcgatccagcacgagcccgccacgggggatctctatctgacc
ctcggtcggctgccccgccagggcgaggccgtcggcgcggcgagcttcttcgtcacaacg
cgggcaggatacacttatcaggtcgagcttgcggccaaggcgacgccgtccacccagatc
gaggtgcgaaaccctgaccttgcccgccgccagacggaacgggcgcttgccgaaacgtcg
ctcgatgaggaagtcgtcgccctgacccgcgccatgtgggccagtgcattgctcgacggc
tatgagatcaagcggccggttgttcgcgagcgggccgccgggacgctgcgcctcgcggtc
cgggcaacctatgaaagcgacgcgcttcagggacgtgtgctgattgcccgcaatccgagc
cgcggtgacgtggcgatcgaggaaagcctgttcctggcgccgggcgttgcggcggtgacc
atccaaggaccgcgtgttctcggtcccggcgcatccgtccccgtcctcatcgtcgatcgg
gggcagccgtga

DBGET integrated database retrieval system