KEGG   Parvularcula bermudensis: PB2503_01162Help
Entry
PB2503_01162      CDS       T01298                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase, hypothetical
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pbr  Parvularcula bermudensis
Brite
Enzymes [BR:pbr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PB2503_01162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_23 MTS Methyltransf_11 PrmA Methyltransf_12 CMAS Methyltransf_32 Methyltransf_18 Ubie_methyltran Tir_receptor_C DUF3429 RrnaAD MetW
Motif
Other DBs
NCBI-ProteinID: ADM08312
UniProt: E0TBA8
Position
complement(134919..135578)
Genome map
AA seq 219 aa AA seqDB search
MMDTIEARKHMVDSQVRPNDVTDPALVRAMSTVPREAFVPTNRRSLAYVEKDVPLFDGRW
LLKARDFSKLVHGATIQPGDLVLDIGCGYGYSSAVISFLAGVVVGLEADDRPIERATETC
RTHGYDTVAFVQGTLAEGCPKQGPYDVIVIEGGIETLPDTLFAQLKPNGGRLVAIMCEDG
VGHATLWTRHGEKRGHRILFEAYPAGILPGFEKERAFVF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgatggatacgatagaggcccgcaaacatatggtcgacagccaggttcggccgaatgac
gtcaccgaccctgccttggtgcgggccatgtcgaccgtcccgcgggaggcctttgtcccc
accaatcgccgaagtctcgcctatgtcgaaaaggatgtcccgttatttgatgggcgatgg
ctgctcaaggcacgcgacttctccaagctggtgcatggggccacgatccagcctggcgac
ctggtgctcgatattggttgcggctatggatattcctccgccgtgatctcctttctcgcc
ggtgtcgtggtgggacttgaggctgatgaccgcccgatcgagcgggccacggaaacctgc
cgcacccatggctacgacacggtggcgtttgtgcagggcacgctggctgaggggtgtccc
aagcagggcccctatgatgtcattgtcattgagggcggtatcgaaaccttgcccgacacc
ctgtttgcgcaattgaagccgaatggcgggcgattggtcgcgatcatgtgcgaagacggc
gtggggcacgccaccctttggacccggcatggggaaaaaagggggcacaggatccttttc
gaagcgtatccagcgggtattctgccggggttcgaaaaagaacgcgccttcgtattttaa

DBGET integrated database retrieval system