KEGG   Parvularcula bermudensis: PB2503_01217Help
Entry
PB2503_01217      CDS       T01298                                 

Definition
(GenBank) putative phosphoglucomutase phosphomannomutase protein
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00010  Glycolysis / Gluconeogenesis
pbr00030  Pentose phosphate pathway
pbr00051  Fructose and mannose metabolism
pbr00052  Galactose metabolism
pbr00230  Purine metabolism
pbr00500  Starch and sucrose metabolism
pbr00520  Amino sugar and nucleotide sugar metabolism
pbr00521  Streptomycin biosynthesis
pbr01100  Metabolic pathways
pbr01110  Biosynthesis of secondary metabolites
pbr01120  Microbial metabolism in diverse environments
pbr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PB2503_01217
   00030 Pentose phosphate pathway
    PB2503_01217
   00051 Fructose and mannose metabolism
    PB2503_01217
   00052 Galactose metabolism
    PB2503_01217
   00500 Starch and sucrose metabolism
    PB2503_01217
   00520 Amino sugar and nucleotide sugar metabolism
    PB2503_01217
  Nucleotide metabolism
   00230 Purine metabolism
    PB2503_01217
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PB2503_01217
Enzymes [BR:pbr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PB2503_01217
    5.4.2.8  phosphomannomutase
     PB2503_01217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_II PGM_PMM_I PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADM08323
UniProt: E0TBB9
Position
150371..151870
Genome map
AA seq 499 aa AA seqDB search
MQDLMLPKPLADLAPNTFEYETLPKVKATGFREYDARWLFEKEINLLGIQSLGAGLGTLI
HELGKRPDIVVGHDFRSYSASIKQALIVGLMGAGVRVHDIGLAVSPMAYFAQFDLDVPCV
AMVTASHNENGWTGVKMGVDAPLTFGPDEMGRLKEIVLSGQTKAREGGGYRYVEGVRERY
IADLVKDVKIARPLKVIAACGNGTAGAFAPEALSRLGVEVIPMDDELDHTFPKYNPNPED
MKMLHAMRDAVLTHKADLALGFDGDGDRCGVVDNRGEEIFADKIGVMLARDLSSRHDNAV
FVVDVKSTGLFTADPVLQKQGATTHYWKTGHSYIKRHTTDLNAMAGFEKSGHFFFREPYG
RGYDDGLVAAIAILKMLDNNPEKSLAELREDLPTTYQSPTMSPHCDDDKKYGIVEKIVTH
FEGQKELIGQKVSDVNTVNGVRVTVEDGTWGLVRASSNKPELVVVVESPVSEENRNKMFA
EIEQVMAGYPEIGAFNQKL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatctcatgctgccgaaacctctcgccgacctcgcccctaatactttcgagtac
gagaccttgcccaaggtcaaagccaccggcttccgcgaatatgatgcgcggtggcttttc
gagaaggaaattaacctcctcggcatccagtctctcggcgcgggcctcgggacgctcatc
catgaattgggtaaacggcctgacattgtcgtcgggcacgattttcgcagttattccgcc
tcgatcaaacaagcgttgatcgtcgggctgatgggggctggcgtacgggttcacgatatt
ggcctggccgtctcgcccatggcctatttcgcgcaattcgacctcgacgttccctgcgtc
gcaatggtgacagccagccacaatgaaaatggctggaccggtgtgaaaatgggcgtggat
gcaccgctcacctttggtcccgatgaaatgggccgactgaaagagatcgtgctcagcggc
cagacgaaagctcgggaaggcggcggttatcgctatgtcgaaggggtgcgcgagcgctat
atcgccgacctggtgaaggacgtgaaaattgcccgtcccctcaaagtgatcgccgcctgt
ggtaacgggaccgcgggcgccttcgcaccggaggctctctcccgtctgggggtcgaggtc
atccccatggatgacgagcttgatcataccttcccgaaatataatccgaaccccgaagac
atgaagatgctgcacgccatgcgcgatgccgttctgacgcataaggcggatctggcgcta
ggtttcgacggcgacggcgaccgttgcggcgtggtcgataatcgcggagaagaaatcttc
gccgataagattggggtgatgctggccagagatctgtccagccgccacgataatgccgtc
ttcgtggtggatgtgaaatccaccggcctcttcaccgccgatccggtgctccagaaacaa
ggggccacgacgcattattggaagaccggccatagctatatcaagcgccatacgaccgat
ctcaatgcgatggcggggtttgagaaatcagggcacttctttttccgggagccctatggc
cggggctatgatgatgggttggttgccgccatcgccattctgaaaatgctcgacaacaac
ccagagaagtctctggccgagctccgcgaagatctgcccacgacctaccaatcgcccacc
atgtcgccgcattgcgacgacgataaaaagtacggcatcgtcgagaaaatcgtcacgcat
tttgagggccagaaagagctgatcgggcagaaggtgtcggacgtcaatacggtgaacggc
gttcgcgtcacggtcgaagacgggacctggggactggtccgtgcctcctccaacaaaccc
gaattggtggtggtggtggaaagtccggtctcggaggagaaccgtaacaagatgttcgcg
gagatcgagcaggtcatggccggctatcccgaaatcggcgccttcaatcagaaattataa

DBGET integrated database retrieval system