KEGG   Parvularcula bermudensis: PB2503_03602
Entry
PB2503_03602      CDS       T01298                                 
Name
(GenBank) putative conjugal transfer protein
  KO
K20528  type IV secretion system protein TrbC
Organism
pbr  Parvularcula bermudensis
Pathway
pbr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PB2503_03602
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pbr02044]
    PB2503_03602
Secretion system [BR:pbr02044]
 Type IV secretion system
  Trb secretion system protein
   PB2503_03602
SSDB
Motif
Pfam: TrbC
Other DBs
NCBI-ProteinID: ADM08795
UniProt: E0TDP0
Position
complement(652834..653151)
AA seq 105 aa
MTLTKHTCRALAITFGLIVLVGPAHAAGSGMPWEAPLDSILQSIEGPVAKIVGTLAIIIT
GLTLAFGDTGGGFRKLIQIVFGLSIAFTATSFFLSFFSFGGGATI
NT seq 318 nt   +upstreamnt  +downstreamnt
atgaccctgacgaaacacacctgccgcgcgctcgcaattacgttcggtctcatcgtcctt
gttggtcccgcccatgcggccgggtccggcatgccctgggaagcgcccctcgattccatc
ctccagtcgatcgaggggccggtggccaagatcgtcggcacgctcgccatcatcatcacc
ggcctgacgctggccttcggcgatacgggcggcggcttccgcaaactcatccagatcgtg
ttcgggctctccatcgcgttcacagcgacgagcttcttcctgtccttcttctcgttcggc
ggcggcgcgacgatctga

DBGET integrated database retrieval system