KEGG   Parvularcula bermudensis: PB2503_06407Help
Entry
PB2503_06407      CDS       T01298                                 

Definition
(GenBank) Lipolytic enzyme
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00903  Limonene and pinene degradation
pbr00930  Caprolactam degradation
pbr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PB2503_06407
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PB2503_06407
Enzymes [BR:pbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     PB2503_06407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: ADM09347
UniProt: E0THQ1
Position
1244395..1245318
Genome map
AA seq 307 aa AA seqDB search
MPSLQAKLLNQGTRFTLQQFLGENANVNTLRKIVPPSPGLILPSDVTIERTTAPAGEWLS
PKKEGPAADKTILYLHGGGYVFCTPKTHRALTTRLAKQTGAKVFSVDYRLAPEHPYPAAL
EDALAAWDYLMGKGIDPKSVYVGGDSAGGGLTLALIIALKERGSAVPGGAFLYSPWADLS
HGSESVVENEPTERMLTPAGARKAADMYRGSVDATDPKISPVFADFAGFPPLLVFVSTTE
MLRDDGRRVASRAKEAGVPVELVSKEGLVHAWPLLAPLYPEANTTIGHTARWIVLTSEAS
RGTATAA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcttacaggcgaaattactcaatcaaggcacacggtttacgcttcagcaattt
ttgggggagaatgcgaacgtcaacacccttcgcaagatcgttcccccctctccggggctg
atcttgccctcggatgtgacgattgagcggacgacggcgcctgcaggcgagtggctgagc
ccgaaaaaagaggggccggctgccgataagaccatcctctatctgcacggcggcggctat
gtcttctgcacgccaaagacccaccgcgccctgacgacccggctcgcaaagcagaccggc
gccaaggtcttctctgtggattaccgtctggcgccagagcacccctatcccgcggcgttg
gaggatgccctggcggcgtgggattacctgatgggcaaagggatcgacccgaaatccgtc
tatgtcggtggtgattctgcggggggcggactgaccctcgccctcatcatcgcgctgaag
gagcgggggagcgcggtgcccggcggcgcctttctctactctccctgggccgatcttagt
catggcagcgagagcgtcgtcgagaatgagcccaccgagcggatgttgacccctgccggt
gcgcgcaaggcagccgacatgtatcgcggatcggtggacgccaccgatccgaagatctcg
ccggtcttcgctgattttgccggtttcccgccgctgcttgtctttgtgagcaccaccgaa
atgctgcgggatgatgggcgtcgggtcgccagccgggcgaaagaggccggggtccccgtt
gagcttgtcagcaaagagggccttgtgcacgcatggccgctcttggcgccgctctaccct
gaggccaacacgacgatcggccacaccgcgcggtggattgtcttgacttcggaggcgtcc
aggggcaccgcaacggctgcgtga

DBGET integrated database retrieval system