KEGG   Parvularcula bermudensis: PB2503_07062Help
Entry
PB2503_07062      CDS       T01298                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00071  Fatty acid degradation
pbr00072  Synthesis and degradation of ketone bodies
pbr00280  Valine, leucine and isoleucine degradation
pbr00310  Lysine degradation
pbr00362  Benzoate degradation
pbr00380  Tryptophan metabolism
pbr00620  Pyruvate metabolism
pbr00630  Glyoxylate and dicarboxylate metabolism
pbr00640  Propanoate metabolism
pbr00650  Butanoate metabolism
pbr00900  Terpenoid backbone biosynthesis
pbr01100  Metabolic pathways
pbr01110  Biosynthesis of secondary metabolites
pbr01120  Microbial metabolism in diverse environments
pbr01130  Biosynthesis of antibiotics
pbr01200  Carbon metabolism
pbr01212  Fatty acid metabolism
pbr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PB2503_07062
   00630 Glyoxylate and dicarboxylate metabolism
    PB2503_07062
   00640 Propanoate metabolism
    PB2503_07062
   00650 Butanoate metabolism
    PB2503_07062
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PB2503_07062
   00072 Synthesis and degradation of ketone bodies
    PB2503_07062
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PB2503_07062
   00310 Lysine degradation
    PB2503_07062
   00380 Tryptophan metabolism
    PB2503_07062
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PB2503_07062
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PB2503_07062
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PB2503_07062
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbr04147]
    PB2503_07062
Enzymes [BR:pbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PB2503_07062
Exosome [BR:pbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PB2503_07062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADM09478
UniProt: E0TEA3
Position
1389386..1390600
Genome map
AA seq 404 aa AA seqDB search
MADAYIYDAVRTPRGKGKPDGSLHEITPVQLAAQVLNALNERNDLSRQAVDDVILGCVMP
VGEQGSNIARTAVLVSDLPQETSGVQVNRFCASALEATNMAAAKVMSGEADLAIGGGVEA
MSRVPMSADGGALLSDPAVSFEQYVVPQGISADIIATKYGISRDDADAYAVESHKRAAAS
WARGDFDKQVVPVKDVIGLEILSKDETIRPDSDMQAMGRLNPAFAALGEQMPGFDKVALQ
KYPELERINHIHTAGNSSGIVDGAAGVLVGTKEMGEKLGLKPIAKIRAMASIGSEPTIML
TGPEFVTKKVLARSGMSKNDIDVWELNEAFASVVLRYMQAMDIDHDQMNVNGGAIAMGHP
MGATGAMILGTAIGEMHRTDKETALVTLCIGGGMGTATILERVS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgcttatatttacgatgcggtgcggacgcctcgcggcaaggggaagcctgac
ggctccttgcacgagattacgcccgttcaactggccgcccaggtcttgaatgcgctgaat
gagcgtaacgacctgtcccgccaagcggtcgacgatgtgatcctcggctgcgtgatgcca
gtgggggagcaaggatcgaacattgcccggacggcggtgctggtttctgatctgccccaa
gaaacctccggggttcaggtcaatcggttctgtgcctccgcgcttgaggcgaccaatatg
gccgcagccaaggtcatgagcggcgaggccgacctggccatcggcggcggtgtcgaagcg
atgtcgcgggtgccgatgagcgctgatggtggggcgctgttgtctgatcctgccgtgagc
tttgagcaatatgtcgtcccacaagggatttcggcggatatcatcgcgaccaaatacggg
atctcgcgggacgatgccgatgcctatgccgttgagagccacaagcgggctgcggcgagt
tgggcgcgcggcgatttcgacaagcaagtcgtccccgtcaaagacgtgatcggtcttgaa
attctgtccaaggatgaaacgatccggccggactcggacatgcaggccatgggacgcctc
aaccccgcctttgccgccctcggcgagcagatgcccggtttcgataaggtcgcccttcag
aaatatcccgagcttgagcgcatcaaccacatccacaccgccggcaattcttccggtatc
gtcgatggggccgccggggtgctcgtcgggacgaaagagatgggggagaagcttggcctg
aagccgattgccaagatccgcgcgatggcgtcgattgggtcagagcccacgatcatgctc
accgggccggagttcgtgacgaaaaaggtcctggcccgctccggtatgtccaagaacgac
atcgatgtttgggagctgaacgaagccttcgcctccgtggttcttcgctacatgcaggcg
atggatatcgaccatgatcaaatgaacgtgaatggtggggcgatcgccatggggcacccg
atgggcgcaaccggggccatgatcctcggtaccgcaatcggtgaaatgcaccgtactgac
aaagagaccgcactcgtgacgctgtgtatcggcggcggcatgggaacggccaccattctc
gaacgcgtcagctaa

DBGET integrated database retrieval system