KEGG   Parvularcula bermudensis: PB2503_08499Help
Entry
PB2503_08499      CDS       T01298                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PB2503_08499
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pbr01007]
    PB2503_08499
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pbr03016]
    PB2503_08499
   03029 Mitochondrial biogenesis [BR:pbr03029]
    PB2503_08499
Enzymes [BR:pbr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     PB2503_08499
Amino acid related enzymes [BR:pbr01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   PB2503_08499
Transfer RNA biogenesis [BR:pbr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PB2503_08499
 Prokaryotic Type
   Other AARSs
    PB2503_08499
Mitochondrial biogenesis [BR:pbr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PB2503_08499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon GAD
Motif
Other DBs
NCBI-ProteinID: ADM09755
UniProt: E0TBF8
Position
1689408..1691330
Genome map
AA seq 640 aa AA seqDB search
MRGRMVAKKKSVMASELTLPPAGAMGRVQSMDQDEETGMTPYRTHTCGALRKGDVGSNVT
LSGWVHRKRDHGGLLFIDLRDHHGLTQLVIEPEAPFFAEVEAVRAESVISVEGEVIARGD
EVVNPSLPTGEIEIRLSRFEVLSAAGDLPLPVFGEPDYPEDIRMRHRYLDLRRETMHKNI
VLRSRVISQLRKGMEQREFTEYQTPILTASSPEGARDFLVPSRLHPGKFFALPQAPQIFK
QLIMVSGFDRYFQIAPCFRDEDARADRSAGEFYQLDLEMSFVEQQDVFDATAPVIHEAFA
LFAGDRRVDPYKEWPQIPYAESLLKYGNDKPDLRLPSSLDMQVVTEHFKGSGFKIFASIA
EDPEQQIRAIPAPGGGSRAFCDRMNSWAQKEGLPGMGYIMFDEADGKGPVAKNIGPERTA
AIKAQLGLGAGDAAFFVAGKVESFEAIAGRARVQIGRELGHLDEDRFAFAWIVDFPMYEW
DEENKKVEFGHNPFSMPKGGLSALEKATTPEAQLALKANQYDLVCNGYELGSGAIRNHLP
EVMYRAFAIAGYGADVVEDKFGGMLNAFRYGAPPHGGAAFGVDRIVMLLAGVENIREVTM
FPLTQNAEDYLLGAPAEASAEQLKELHIRLAKPIAEKKVP
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggccggatggtcgcgaagaaaaaatcagtgatggcgagcgagttgacgctcccc
ccggcgggcgccatgggtcgtgttcaatccatggatcaggatgaggagacgggcatgacc
ccctatcgaacccacacttgcggtgccttacgaaaaggcgatgtggggtccaatgtgaca
ctctctggttgggttcaccgaaagcgcgaccatgggggactgttgttcatcgatcttcgg
gaccatcacggccttacccaattggtgatcgagcccgaggcgccttttttcgccgaggtc
gaagcggtcagagccgaaagcgtgatttccgtcgagggcgaggtgatcgcgcgcggggac
gaggtcgtcaatccgtcgctgccgactggagagatcgaaatccggctgagccggtttgag
gtcttgagcgcggcgggggatttaccgctgccggttttcggcgaacccgactatccagaa
gatatccgcatgcgccatcgctatctcgatctgcggcgagagacgatgcacaagaatatc
gtccttaggtcccgcgtgatcagccaattgcgcaaggggatggagcagcgggaattcacc
gaatatcagacgccgatcctcaccgcctcttctcccgaaggggcacgggactttcttgtt
ccctccaggttgcatcccggcaagttctttgcgctgccacaggcgccgcagatctttaag
caattgatcatggtgtcggggtttgaccgctatttccagatcgccccctgcttcagagac
gaggatgcacgggctgaccgttcggcgggggaattctatcagctcgatctcgagatgagc
ttcgttgagcagcaggatgtcttcgatgcaacggcgcctgtcatccatgaggcctttgcc
ctgttcgcaggcgaccgccgtgtcgatccttacaaagagtggccgcaaattccctatgcg
gaatcactactgaaatacggcaatgacaagcctgatctccgcctgccgtcgagcctcgac
atgcaggtggtgaccgagcatttcaaagggtcgggcttcaagatctttgcctcgatcgcc
gaggatcccgaacagcagatccgggccatccccgcgcccggcggcggcagccgggccttc
tgtgaccggatgaatagctgggcccagaaagaggggctgccgggcatgggatatatcatg
ttcgatgaggccgatggcaaaggcccggtggccaagaatatcggccctgaacggacggcc
gccatcaaggcgcaactcggccttggggccggcgatgcggcctttttcgtcgcgggaaag
gtcgaaagcttcgaagccattgcgggcagggcgcgggtccagatcgggcgggaacttggc
catctcgacgaggaccggttcgcttttgcctggatcgtcgatttcccgatgtatgaatgg
gacgaagagaataaaaaggtcgagttcggccacaatcccttttcaatgccgaaaggggga
ctttcggcgctggaaaaggccacgactcccgaggcgcaactcgcccttaaggccaatcaa
tatgaccttgtatgcaatggctatgagctggggtcgggggcgatcagaaaccacctgccg
gaggttatgtatcgtgcctttgcgattgctggatacggtgccgatgtggtcgaggacaaa
ttcggcggtatgctgaatgccttccgctacggggcgcccccccatggcggcgcggccttc
ggtgtggaccgcatcgtcatgcttctggcaggtgttgagaatatccgagaggtgacgatg
ttccccctgacgcagaatgcggaggactatctgctcggcgcaccggcggaggcgagtgcc
gagcagctcaaagagcttcacatcaggcttgccaaaccaatcgctgagaaaaaagtccct
taa

DBGET integrated database retrieval system