KEGG   Parvularcula bermudensis: PB2503_08824Help
Entry
PB2503_08824      CDS       T01298                                 

Definition
(GenBank) putative alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00790  Folate biosynthesis
pbr01100  Metabolic pathways
pbr02020  Two-component system
Module
pbr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PB2503_08824
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PB2503_08824
Enzymes [BR:pbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PB2503_08824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N Metallophos_2 TAT_signal Metallophos
Motif
Other DBs
NCBI-ProteinID: ADM09820
UniProt: E0TC27
Position
complement(1759985..1761643)
Genome map
AA seq 552 aa AA seqDB search
MPLIHRRTVLGGLGAAALAPALSSPALAGIGPFTRFRHGVASGDPRHDRVIIWTRVTPRS
REEDRGNLLVRWRMATDPLMTQIVGQGITAATINRDFTVKVDVERLLPDRTYYYDFRIEG
TFDTSPIGRTKTFPAPGAATHRLRYAFVSCSHYNAGYFHVYRAIANRADLDVVLHLGDYI
YEYGPGQFGDNQLEGRALLPEKEIVTLDDYRARYALYRTDPDLQEAHRQHPFMTVWDDHE
TANNAWRDGAQNHTPETEGDWTTRRAAGVRAYFEWLPIRETALPSPITNEAEAVGPDTQR
IWRSARYGDLADFLMLDTRLYGRDEQVGIIGPDIGDPSRSLLGPEQEQWLTDCLIASQFS
GTRWRFLGQQVMFSKLIGENVEKADIAFNADQWDGYGASQERLLDTIVSGGIENLAVLTG
DIHSSWAFDVPLAPYDSDTYKRFTGEGSIAVEFVTSSVTSPSIPGVETSTVIDRLGVAAM
PHLKWLNLTERGYCLVDVSHERTQCEWWFVEDVRAPSGGSEYLARAYYTDDGATRLRRSR
MPSLPKPSAPPA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
gtgccattgattcatcgtcgcaccgttctgggtgggcttggtgctgcggcgctggccccc
gcgctctcctcgccggcccttgcgggcatcggcccgttcacccgatttcgccacggcgtc
gcctcgggcgatccccgccacgaccgcgtgatcatctggacgcgggtgacccctcgttcc
cgcgaagaggatcgcggcaatctgctggtccggtggcgaatggccacagaccctctgatg
acccagattgtgggccaaggcatcaccgccgccacgatcaaccgtgacttcacggtcaag
gtcgatgtcgagcggttactgcccgatcgaacctattattacgatttccggatcgagggg
acattcgatacctcccccatcggacgcacaaagacgttcccggcccccggcgccgcgacc
catcgcctgcgatatgcctttgtctcgtgctcccactataacgctggatattttcacgtt
tatcgcgccattgccaaccgtgccgatctcgacgtcgttctccatctcggcgactatata
tacgagtacggaccagggcagttcggcgacaaccagctcgagggtcgggcgctgctgccc
gagaaggaaatcgtcaccctcgacgattatcgcgcacgatacgcgctgtaccgaaccgac
cccgatttgcaggaagcgcaccgccagcaccctttcatgaccgtgtgggacgatcacgaa
accgccaacaatgcctggcgggacggcgcccaaaaccatacccccgaaaccgagggggac
tggacaacccggcgggcggctggggttcgtgcctattttgaatggttaccgatccgggag
accgccctcccctcgccgatcaccaatgaggcggaggccgtcggccccgatacccaacgg
atctggcgaagcgcccggtacggtgatctggcggatttcttgatgctcgacacccgtctt
tacggacgcgacgagcaggtcggcatcatcggccctgacatcggcgacccctcccgcagc
ctgctcggcccggagcaggaacaatggctcaccgattgcctcatcgcttcgcaattctcc
ggcacgcgctggcgctttttggggcagcaggtcatgttctcgaaattgatcggcgagaat
gtcgagaaggccgatatcgccttcaacgccgatcagtgggatggctatggcgcttcccag
gaacggttgcttgatacgatcgtcagcggcggcattgagaatctcgccgtgctgacgggg
gatatccatagttcctgggcctttgatgttcccctcgctccctatgacagcgatacctac
aagcggttcaccggcgagggatcgattgcggttgagtttgtgacctcatcggtcacctcg
ccctcgatcccgggcgtcgagacctccaccgtgatcgaccggctgggggtcgcggccatg
ccgcatctgaaatggctgaacctgaccgaacgcggatattgcctcgtcgatgtcagccat
gagcggacacaatgcgaatggtggttcgtcgaagatgtacgcgcaccgagcgggggcagc
gagtatctggcccgtgcctattacaccgacgacggggcgacccgcctgcgccggtcgcgc
atgccctctctgccgaagccgagtgcgccgccggcataa

DBGET integrated database retrieval system