KEGG   Parvularcula bermudensis: PB2503_10844Help
Entry
PB2503_10844      CDS       T01298                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00010  Glycolysis / Gluconeogenesis
pbr00260  Glycine, serine and threonine metabolism
pbr00680  Methane metabolism
pbr01100  Metabolic pathways
pbr01110  Biosynthesis of secondary metabolites
pbr01120  Microbial metabolism in diverse environments
pbr01130  Biosynthesis of antibiotics
pbr01200  Carbon metabolism
pbr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PB2503_10844
  Energy metabolism
   00680 Methane metabolism
    PB2503_10844
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PB2503_10844
Enzymes [BR:pbr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PB2503_10844
Membrane trafficking [BR:pbr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PB2503_10844
Exosome [BR:pbr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PB2503_10844
  Exosomal proteins of melanoma cells
   PB2503_10844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADM10220
UniProt: E0THS7
Position
2169977..2170684
Genome map
AA seq 235 aa AA seqDB search
MPRICLVRHGQSRWNLENRFTGWVDVDLTEKGEAEARRAGELMKAETFKPVRAFTSVQTR
AIRTLNIALHALDRLWVPVTKDYRLNERHYGGLTGLDKAETAVKHGEDQVKIWRRSYDTP
PPPLDDPSPFPSLTDERYAGIEVPKTESLKLTLDRVAPYWQSTIVPAISEGDLLIAAHGN
SLRALVKLLFAVGDDEITSVEIPTGNPLLVELNNQMRASSAKYLDDSRAQALPKI
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtatttgcttggtgcgacacggtcaaagccgctggaacctcgaaaaccgcttt
accggatgggtcgatgtcgacctgaccgagaagggggaggcggaggcccgtcgggcaggg
gagttgatgaaggcggaaaccttcaagcccgttcgtgcctttacgtcggttcaaaccagg
gccatccgaaccctgaatattgcattgcatgccctcgaccggctttgggtgccggtgacc
aaggattatcgccttaatgagcggcattatggcgggctgaccgggctcgacaaggccgag
acggcggtcaaacacggcgaggatcaggtaaaaatctggcgtcggagctatgataccccg
ccgccgcccctcgatgatccttcgccctttccgtctctgacggatgaacgctatgccggt
atcgaggtccccaagacggagagcctgaagctcaccctcgaccgcgtggctccttattgg
caatcgaccattgtgcccgccatttccgagggcgatttgttgatcgccgcccatggcaat
tcgctcagggcgcttgtcaaactccttttcgccgttggcgacgatgagattacgtcggtc
gagattccaacgggcaatcccctcttggtggagttgaacaaccagatgcgggcctcctcg
gcaaaatatttggatgactcgcgcgctcaggcgttgccgaagatttga

DBGET integrated database retrieval system