KEGG   Parvularcula bermudensis: PB2503_12554Help
Entry
PB2503_12554      CDS       T01298                                 

Definition
(GenBank) conjugal transfer protein traG
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PB2503_12554
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pbr02044]
    PB2503_12554
Enzymes [BR:pbr01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     PB2503_12554
Secretion system [BR:pbr02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   PB2503_12554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind
Motif
Other DBs
NCBI-ProteinID: ADM10549
UniProt: E0TFI9
Position
2553515..2555353
Genome map
AA seq 612 aa AA seqDB search
MAGILDHQPRLGGPWFELAGQPVYKPWRLFQWWYAYDAYAPDVFARAGLIASLGGIAGVV
MAIIASLWRARREKNATTYGSARWSSARDVRRSGLLGTSGVVLGRFRGRYLRHAGAEHVM
AFAPTRSGKGVGLVIPTLLSWTGNAIIHDIKGENWALTSKWRSDFSRCVRFDPTDLSSSR
FNPLLEVRLGAHEVRDAQNVADILVDPDGSLERRSHWDKTAHSLLVGAILHVLYAEDDKS
LAGVATLLSDPARPIDDTLERMLEANHLGSRNRPLTHPVVAEAARELLNKSENEKSSVVS
TAISFLGLYRDPVVQRATSGSDWRIEDLFRGESPASLYLVVPPSDLSRTKPLMRLILNQI
ARRLCEELPDGKDRRQTLLMLDEFPALGRLDFFESSLAFMAGYGIRAFLIAQSLNQVEKA
YGQNNSILDNCHVRIAFATNDERTAKRISDMLGTTTEQRNQKNYTGHRLAPWLSHVMVSQ
QETQRPLLTPGEVMQMPADDALIFLASHPPIRAKKLRYYEDRNFTERVGALPVNSAGADA
MRFGGYHRSGPSPSDGNSGGLARAVGPDIGDEDEISQDIANEEEHAPQQRGGIQDQIARY
YLQVQENGGREL
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggtattctggaccatcaaccgcgtttgggcggaccctggttcgagcttgcgggt
cagccagtatacaagccgtggcggctgttccagtggtggtatgcctatgatgcttatgcg
ccagacgtgtttgcgcgtgcgggtttgattgcctcgctgggtggcatcgccggtgttgta
atggcgatcatcgcgtcgctctggcgggcacgacgcgagaagaatgcgacgacctatggc
tctgcgcgctggtcatcggcgcgggacgttcggcgatctggtctgcttggtacgtctggc
gtagtgctgggacgattcagaggccggtatctccggcatgcgggcgccgagcatgtcatg
gccttcgcgccgacccggtcgggcaaaggtgttgggttggtgatccctacccttctgtcc
tggacaggcaatgcgatcattcatgacatcaagggagagaactgggcgctgacgtcgaaa
tggcggtcggacttctctcgatgcgttcggttcgatccgacagacttgtcgagttcacgc
ttcaatcccttgctggaagtgcggctcggggcacatgaggtccgcgacgcgcagaatgtg
gcggacattctggtcgatcctgatggctctctggagcggcgtagccattgggacaagacg
gcgcattcactgctcgttggtgccatcctgcacgttctatatgccgaagatgacaaatcg
ttagcgggcgtggcgacgctgctgtctgatccagcccggccgatcgatgatacgctggag
cgcatgcttgaggcgaaccatttgggaagccgcaaccggccattgacgcatcccgttgtg
gcggaggcggcacgtgaacttctgaacaagtcggagaacgaaaagtcatcggtcgtgtcg
acggccatttcgttcctggggctctaccgcgatccggttgtccagcgggcgacctccggt
tcggattggcgaatcgaggatttgtttcgcggcgaaagtcctgcgtcgttgtatctggtg
gttccgccgtctgatctctcgcggaccaagccgttgatgcggttgatcctcaatcagatt
gcccggcggctttgcgaagagctgccggatggaaaagaccgccggcagaccctgttgatg
ctagacgaattccctgcgcttggacgtctggacttcttcgagagttcgctcgccttcatg
gccggttatgggatccgcgccttcctcattgctcagtctctgaaccaggtcgagaaggcc
tatgggcagaacaattcaatcctcgacaattgccatgtccggatcgcgttcgcgacgaat
gacgagcgcactgccaagcgtatttcagacatgctcggcaccacgacagagcagcgaaac
cagaagaattataccgggcaccggctcgcgccctggctcagtcatgtcatggtctcgcaa
caggaaacccaacgcccgcttctgacgcccggcgaagtaatgcagatgccggccgatgac
gcgctgatcttcctggcgagccatccgccgatccgggcgaagaagctccgttactatgaa
gatcgtaacttcactgagcgggtcggtgcgttgccggtcaactcagcgggtgcagacgca
atgcggttcggtggatatcatcgatctggaccatccccctcagacggtaattccggcggg
ctggcgcgagcggtgggaccggacatcggcgatgaggatgagatctcgcaggatattgcg
aatgaggaagagcacgcacctcagcagcgtggcggcattcaggaccagatcgcgcgctac
taccttcaagtccaggaaaatggcggacgggagctttag

DBGET integrated database retrieval system