KEGG   Parvularcula bermudensis: PB2503_12594
Entry
PB2503_12594      CDS       T01298                                 
Name
(GenBank) conjugal transfer protein trbe
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PB2503_12594
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pbr02044]
    PB2503_12594
Enzymes [BR:pbr01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     PB2503_12594
Secretion system [BR:pbr02044]
 Type IV secretion system
  Trb secretion system protein
   PB2503_12594
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_22 AAA_10 AAA_21 TrwB_AAD_bind TraG-D_C HerA_C ABC_tran AAA_16 AAA_29 DUF87 NACHT FtsK_SpoIIIE DEAD AAA_25 AAA_30 AAA_7 AAA_23 T2SSE
Other DBs
NCBI-ProteinID: ADM10557
UniProt: E0TFJ7
Position
2563300..2565738
AA seq 812 aa
MLNLSEYATRQASLADFLPWACLVAPGVVLNKDGAFQTSFRYRGPDLESSTEAELVAVTA
RVNNVLRRFGSGWALFFEAVRAEAVSLEESEFACAAAWLIEQERRAAAEETGARFESAYY
LTLLWLPPADATGQAEKALIERPEKRDGEDWRQRLEHFQTRAAQTLDLLSTALDEIHPLS
DEETLTYLHACISSKRHAVSVPELPVFLDAVLADESFAGGLEPRIGEAHLATLTLLGFPA
STLPGMLDELNRLGFSYRWTTRYIAMDKAEAEKLLAKKRRHWFAKRKSVGAVLRETLFNE
QAALLDNDADNKAADADAALQELGSDLVSYGYVTTTLTLMGSSREEVEERTRAVERVING
RGFTTIRETLNAVEAWLGSLPGHVYANVRQPILHTLNLAHLVPISSVWAGDAWNDHLSDR
ALIEAQTEGTTPFRLNMHVGDVGHTLIIGPTGSGKSVLLSLLAAQWQRYSDAQVFLFDKG
RSARAVTLAMEGTWLPLAGDERPALQPLRDIDTDRGASFAADWLLGLIEAEGVTVTPDLK
SVLWDAVRSLSSAPVAERTLTGLSLILQSDKLKAALHPYTLEGAYGHLLDSDAEALDLSA
VACFEMDELMQTPSAVAPVITYLFHRLEDRFYGRPTLLILDEAWLFLDHPVFAARLRDWL
KTLRKKNVAVVFATQSLADIEGASIAPALIESCPTRIFLPNERALEPTAQAIYRRFGLND
RQIDILAKAIPKRDYYYTSPHGCRLFELGVGDVALAFCGAASPADQKLMDGLLEADAETG
FARGWLELKQLGWAADLLAGQPDAPLPQIAAE
NT seq 2439 nt   +upstreamnt  +downstreamnt
atgctgaacctctctgaatacgcgacccggcaggccagtcttgccgatttcctcccctgg
gcgtgcctggtcgcgccgggcgtcgtcctcaacaaggacggcgccttccagaccagcttc
cgctataggggccccgaccttgaaagctcgacggaagccgaactcgttgcggtcaccgct
cgggtcaataatgtgctccgccggttcgggtccggctgggcgctcttcttcgaagcggtg
cgggcggaagcggtctcgctggaagagagtgagtttgcatgcgctgccgcctggctgatc
gagcaggaacgccgcgcagccgccgaggagaccggcgcccgcttcgagagcgcctattac
ctcacactactctggctgccgcccgccgatgcgacggggcaggccgaaaaggccctgatc
gagcggcccgaaaagcgtgacggcgaggactggcgccagcggctggagcacttccagaca
cgcgcggcgcagacactcgatttgctgtcgactgcattggacgagatccatccgctctcg
gatgaagagaccctcacctaccttcatgcttgcatctcgtcgaagcggcatgccgtgtcg
gttccggaactgccggtctttctcgatgcggtgctggccgatgagagttttgcgggcggg
ctcgagccgcggattggcgaggcgcatctagcgacgctgaccctgcttggctttccggcc
tcgaccctgcccggcatgctggatgagctgaaccggcttggcttctcctatcgctggacg
acgcgctatatcgcgatggacaaggccgaggccgaaaagctcctcgccaagaagcgccgg
cactggttcgccaagcgcaaatccgttggagccgtccttcgagagacgcttttcaacgaa
caagccgcgcttctcgacaatgatgccgacaacaaggcggccgatgccgatgcggcgttg
caggagcttggctctgatcttgtctcctatggctatgtcaccaccacgctgaccttaatg
gggtcctcgcgtgaggaagtcgaggagcgcacccgcgccgtcgaacgcgtgatcaatggg
cgcgggttcacgacgatccgcgagacgctgaacgccgtcgaagcctggcttggctccctg
ccgggacatgtctatgccaatgtccgccagccgatcctgcatacgctgaaccttgcccat
cttgttccgatatcttcggtctgggcgggcgatgcctggaacgatcatctgtccgatcgc
gcgctaatcgaagcgcagaccgaaggcacgacgccgttccggcttaacatgcatgtcggc
gatgtcggccatacgctgatcattgggccgacaggctccggcaaatcggtactcctgtcg
ctgctggcggcgcaatggcagcgctatagcgatgcgcaggtgttcctcttcgacaaggga
cgatccgcgcgggcggtgacgctcgccatggaaggcacctggctgccgctggcgggcgat
gagcgtccggcattgcaaccgcttcgggatatcgacaccgaccgcggcgcaagctttgcc
gcagactggctgctcgggctgatcgaagccgagggcgtgaccgttacgccggacctgaag
tccgtcttgtgggacgcggtgcgatcgctgtcgtcagcaccagtcgcagagcgcacactg
accgggctcagcctcattctgcaatcggataagctgaaagcggcgctccatccgtacacg
ctggaaggggcctatgggcacctactcgacagcgatgcggaagccctcgacctttctgcg
gttgcctgtttcgagatggacgagctgatgcagacgccatctgcggtcgcgccggtcatc
acctatctcttccacaggctggaagaccggttctatggccgcccgaccctgctcattctc
gatgaagcctggctgttccttgatcatccggtgttcgcagcgcgcctccgcgactggctt
aagacgcttcggaaaaagaacgtcgccgtcgtgtttgcgacccagtcgcttgccgacatt
gaaggggcgtccattgcgcccgccctgatcgaatcctgcccgacaaggatcttcctgccg
aatgagcgtgcgctcgaacccactgcccaggccatctatcgccggttcggactgaacgat
cgccaaatcgacattctcgccaaggcaatcccgaagcgggactattactatacctcgccc
cacggctgtcggctcttcgagcttggcgttggcgatgtcgcccttgccttttgcggcgcc
gcttcccccgccgaccagaagctcatggatgggcttctggaagccgacgcggaaacgggc
ttcgcccgtggctggctggagttgaaacagctcggctgggcagccgacctgctggccgga
caacccgatgcacccctcccccaaatcgccgctgaatag

DBGET integrated database retrieval system