KEGG   Rubinisphaera brasiliensis: Plabr_0467Help
Entry
Plabr_0467        CDS       T01431                                 

Definition
(GenBank) pyrophosphate-dependent phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
pbs  Rubinisphaera brasiliensis
Pathway
pbs00010  Glycolysis / Gluconeogenesis
pbs00030  Pentose phosphate pathway
pbs00051  Fructose and mannose metabolism
pbs00052  Galactose metabolism
pbs00680  Methane metabolism
pbs01100  Metabolic pathways
pbs01110  Biosynthesis of secondary metabolites
pbs01120  Microbial metabolism in diverse environments
pbs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pbs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plabr_0467
   00030 Pentose phosphate pathway
    Plabr_0467
   00051 Fructose and mannose metabolism
    Plabr_0467
   00052 Galactose metabolism
    Plabr_0467
  Energy metabolism
   00680 Methane metabolism
    Plabr_0467
Enzymes [BR:pbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Plabr_0467
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Plabr_0467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADY58094
UniProt: F0SS83
Position
556564..557595
Genome map
AA seq 343 aa AA seqDB search
MKVGILTGGGDCPGLNAVIRGVVQVISNAGGQCLGLQEGWRGAITGEHEILTPEMTRPII
DQGGTILGSSRTNPFKNPEEIEQIEKTFKNLGMDALVAIGGDDTLGVASKLYHEKGLPTI
GCPKTIDNDLSATDQTFGFDTCINIVMDAVDRLRTTAMSHRRVLVVEVMGRHAGWIACYS
AMATGADYFMVPEREVNIDEMINVLQKRLDAGQKYGIVVVSEGAKLSNDGDFVTKDAEID
EFGHVKLGGIGDRVAKIIEERMGKETRSVTLGHLQRGGSPSAFDRVLGTRLGVHAGHLAL
NKDFGKMVALRGTKIVAVELKDAVDKMRELEDSFFDEAAEFLK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcggtatcttgacgggcggcggtgactgccccggtttgaacgcggttatccgt
ggcgtggtgcaggtcatttccaacgctggcggtcagtgcctcggcctgcaggaaggatgg
cgcggagccatcaccggcgaacacgaaatcctgactcccgagatgactcgcccgatcatc
gatcagggcggcacgatcctcggctcttcccgaaccaacccgttcaaaaacccggaagag
attgagcagattgagaaaaccttcaaaaacctgggaatggatgctctcgtcgccatcggt
ggcgatgacaccctgggtgtggccagcaagctgtaccacgaaaaaggcctgccgactatc
ggctgcccgaaaaccatcgacaacgacctgagcgctaccgatcagacgttcggtttcgat
acctgtatcaacattgtcatggacgctgttgaccgcctgcgtaccaccgcgatgtctcac
cgccgtgtcctggtcgtcgaagtgatgggccgtcacgctggctggatcgcctgttattcc
gccatggccaccggtgctgactacttcatggtgccggaacgcgaagtcaacatcgacgaa
atgatcaacgtgctgcagaaacgtctcgacgccggccagaaatacggcatcgtcgtggtc
agcgaaggcgccaaactgagcaacgacggcgacttcgtcaccaaagacgcagaaatcgac
gagttcggccacgtcaaactgggcggcatcggcgatcgcgttgccaaaatcatcgaagaa
cggatgggcaaagaaacccgttcggtcacactgggtcacctgcagcgtggtggcagcccg
tctgccttcgaccgcgtgctcggaacccgcctgggtgtgcacgccggccacctcgctttg
aataaagacttcggcaaaatggttgctctccgcggcaccaaaatcgtcgccgtcgaactg
aaagacgctgtcgacaaaatgcgtgaactcgaagattccttcttcgacgaagccgccgaa
ttcctgaagtaa

DBGET integrated database retrieval system