KEGG   Rubinisphaera brasiliensis: Plabr_2886Help
Entry
Plabr_2886        CDS       T01431                                 

Definition
(GenBank) 3-hydroxybutyryl-CoA epimerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pbs  Rubinisphaera brasiliensis
Pathway
pbs00071  Fatty acid degradation
pbs00280  Valine, leucine and isoleucine degradation
pbs00281  Geraniol degradation
pbs00310  Lysine degradation
pbs00362  Benzoate degradation
pbs00380  Tryptophan metabolism
pbs00410  beta-Alanine metabolism
pbs00640  Propanoate metabolism
pbs00650  Butanoate metabolism
pbs00903  Limonene and pinene degradation
pbs00930  Caprolactam degradation
pbs01040  Biosynthesis of unsaturated fatty acids
pbs01100  Metabolic pathways
pbs01110  Biosynthesis of secondary metabolites
pbs01120  Microbial metabolism in diverse environments
pbs01130  Biosynthesis of antibiotics
pbs01200  Carbon metabolism
pbs01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pbs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Plabr_2886
   00650 Butanoate metabolism
    Plabr_2886
  Lipid metabolism
   00071 Fatty acid degradation
    Plabr_2886
   01040 Biosynthesis of unsaturated fatty acids
    Plabr_2886
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Plabr_2886
   00310 Lysine degradation
    Plabr_2886
   00380 Tryptophan metabolism
    Plabr_2886
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Plabr_2886
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Plabr_2886
   00281 Geraniol degradation
    Plabr_2886
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Plabr_2886
   00930 Caprolactam degradation
    Plabr_2886
Enzymes [BR:pbs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Plabr_2886
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Plabr_2886
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Plabr_2886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_Gly3P_dh_N Pyr_redox_2 adh_short_C2 NAD_binding_2 F420_oxidored UDPG_MGDP_dh_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADY60485
UniProt: F0SFM5
Position
complement(3469687..3471831)
Genome map
AA seq 714 aa AA seqDB search
MRDWKHWKLEVDEASATLWIDVPGQSQNVFSDAVLSELDDVLTALEGETQLACVFIRSRK
PTSFFAGADIREFTAIETREQAMAVSERGQQLFQRIADLKPAVVAVIQGACLGGGLEMAL
ACDYRVAVDDPSTRLGLPETELGILPGWGGTQRLPPLVGMLQAIGMILQARKLPARGARK
AGLVDLVCSPADVEMTVDKLKEKLTADGTLGKADVQRTWLGWFFNETSWGRSLAVGGTEK
KIARQTKHYPALGKALQAIRLSRIDQAKGFEFERQAIADLLFTPTCQNLVRLFLLREKAR
SVATWTSIENVPETKTLAVLGGGTMGAGIAQLAAKTGLGVVLKEIDESAMHAAEERIEEA
HQALVSRGRLTTSQATQQKQAIKFTTEWSQLEKADVVVEAVPESIDLKKTVFQETARHCP
QTTVLASNTSALSVTEIATAVDSPARIGGLHFFNPVHRMDLVEVIQAEQTDESTMAQLVQ
LSRKLGKTPVVVKDSPGFIVNRILMPYLDEAVKLAVERTARGQDLSVIDLDMKRFGMPMG
PLELLDQVGLDVAAHVADSMTVVFGDESLTATIMKRFLDEGRMGRKSGNGFYSYPAGKRG
QLQNFKELLGGLDIDLPEEPSTPFNTEYSIIQQRLVFAMVNEAGRCLAEEIVAEDWAIDL
AMVLGTGFAPFRGGPLAFARQFEAQTVHDTLRALAGSYGPRFEPADCFGPTQHA
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgactggaaacactggaaactggaagtcgacgaggcgtctgcgacattgtggatt
gatgtcccgggacaatctcagaatgtcttttccgatgcagtattaagcgaactggacgac
gttctgaccgctcttgagggagaaactcagcttgcctgcgtcttcattcgctcacgcaaa
ccaaccagctttttcgctggagcggacatccgtgaattcacagccattgaaactcgcgag
caggcaatggctgtttccgaacgcggacaacagctgttccaacggattgccgacctgaag
ccggccgtcgtggctgtgattcaaggagcctgcctcggaggtggtctcgaaatggcactc
gcttgcgactatcgcgtcgcagtcgacgatccttcaacccggttgggcttgcccgaaaca
gaattgggaattctgcccggctggggcggcactcaacgtctgccaccgctggtggggatg
ctgcaggcaatcggcatgattctgcaagccaggaaactaccagcccggggagctcgaaaa
gcgggactggtagatcttgtctgctcgccggctgacgtcgaaatgactgtcgacaagctg
aaagaaaaactgactgccgacggcacactcggaaaggccgatgttcaacgcacctggctg
ggatggttctttaacgaaaccagctggggccgttcgctggcggttggcggcactgagaaa
aaaattgcccggcagacgaagcactatcccgcccttggaaaggcgctgcaggcaattcgc
ctttctcgaattgatcaggcgaaaggttttgagttcgaacgtcaagcaatcgccgatctg
ctgttcacgcccacctgccagaatctggtcaggctgttcctgttgcgcgagaaagcacgc
agcgtagcgacgtggacttccatagaaaatgtgccagaaacgaaaacgctggccgttctc
ggcggtgggaccatgggagcggggattgcccaactggctgcaaaaaccggtctcggcgtg
gtgctgaaagaaatcgatgagtcggccatgcatgcagccgaggaacgtatcgaagaagcc
catcaggcactggtcagccgagggcggttaacgaccagtcaggctacgcagcagaagcag
gcaattaagttcacgacagaatggagtcaactcgagaaggcagacgtggtcgtcgaagct
gttccggaaagcattgacctgaagaaaacagtatttcaggaaaccgcgagacactgtccg
caaacaaccgttctggcgagcaatacgtctgcgctgtctgtgactgaaattgcaacggct
gtggactcgcctgctcgaatcggaggactgcatttcttcaatccggtccatcgcatggat
ctggtcgaagtcattcaggcggaacagaccgacgagtcaaccatggcgcagctggtgcag
ctttcacgcaagttgggaaaaacgccggtcgtcgtgaaagactctcccggctttatcgtc
aaccggatcctcatgccctatctggacgaggcggtcaaactggcggtggaacggaccgca
cgcgggcaggacttgtccgtgattgatctcgacatgaagcgtttcggcatgccaatggga
ccgctggaactgcttgatcaggtcggactggacgtggctgctcacgtagcggactcgatg
accgtcgtcttcggcgatgagtcactgactgcgacgattatgaaacgctttctcgatgaa
ggcagaatgggtcgaaaatccggcaacgggttttactcctacccggccggcaaacgtggc
cagctgcagaatttcaaagagcttctcggcggcctcgacattgatctgccggaggaacct
tcgacgccgtttaacaccgaatattcaatcatccaacagcgactcgtctttgcgatggta
aatgaagccggccgttgccttgctgaagaaattgtcgccgaagattgggcaattgatttg
gcgatggttctgggaaccggattcgctccattccgaggcgggccgttggcattcgcccga
caattcgaagcccagaccgtgcacgatacactccgggcactggcaggttcgtacggacca
cgcttcgagccggcggactgctttggcccaacacaacatgcctag

DBGET integrated database retrieval system