KEGG   Rubinisphaera brasiliensis: Plabr_3574Help
Entry
Plabr_3574        CDS       T01431                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
pbs  Rubinisphaera brasiliensis
Pathway
pbs00020  Citrate cycle (TCA cycle)
pbs00620  Pyruvate metabolism
pbs01100  Metabolic pathways
pbs01120  Microbial metabolism in diverse environments
pbs01200  Carbon metabolism
pbs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Plabr_3574
   00620 Pyruvate metabolism
    Plabr_3574
Enzymes [BR:pbs01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     Plabr_3574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp ATP-grasp_3 HlyD_D23 HlyD_3 ATP-grasp_4 RnfC_N GCV_H NQRA GARS_A YqfD ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ADY61171
UniProt: F0SP68
Position
complement(4401146..4404700)
Genome map
AA seq 1184 aa AA seqDB search
MAAVCQFGTDQLSFALVRTERCKVTCASDKSLEREELMKPIKKLLVANRGEIAIRIFRSA
TELGIRTVAIYSYEDRYALHRFKADEAYQIGKEGEPIRTYLNIDQIIEQAVECGVDAIHP
GYGFLSENPDLARACEKAGIVFVGPSVESLEQLGDKTTARQLAEKAGVPVLSGSGAALVS
AEEGLKQAEELGYPVILKAAKGGGGRGMRVVRSEDELVPAFESAQHEAKTAFGSGDVFIE
KFIERARHIEVQILGDQHGNLTHLFERDCSVQRRHQKVVEMAPAPKLSDKARKTLLESAL
AIGKVVNYHAAGTVEFLVDAATEEVYFIEVNPRIQVEHTVTEEVTGVDIVKTQIQVSSGL
KLTDPEIGIDPDNPPQPNGFAIQCRITTEDPANKFTPDYGRVSHYRSASGMGIRLDAGSA
FSGAVVNPFYDSLLVKVTAHGRNFAETSRRILRSLQEFRIRGVKTNIPFLTKVVTHPTFQ
AGECTTRFIDQTPELFEFPLRQNRATKILTYIGETIVNGNPLVKDRPKAARRDPAPLPEI
PAGLELPKGTRDKFLELGAADFSKWIKDQKRLMLTDTTFRDAHQSLHATRFRTYDLLNIA
ETYSYLCPNLFSLEMWGGATFDTSMRFLKESPWQRLADIREKVPNILTQMLLRASNAVGY
TNYPDNVVVAFVKEAAQTGMDVFRVFDALNWTPNMKLAMEAVIDTGMICEASICYTGDIL
DPKRTKYDLKYYVNLAKELEKMGAHILAIKDMAGLCKPDAAALLVRTLKQEVDLPIHFHT
HDTAGIQAAAIFNAAKEDLDIADGAMAPMSGGTSQPNLNTVVGALQFSDRNPDLNSDALD
DIATYWRAVREFYAPFESAVLPATSDLYKHEMPGGQYTNLFEQARALGLSDRWAEVCDIY
ADVNQLFGDIVKVTPTSKSVGDMALFMVANDLTAVDIMDKSRELAFPASVIDLIGGMMGQ
PPGGFPEEIKKIVLKDKEGLTDRPGASLPPADWDQATKDVAGLLGREPSNAEVVSYLLYP
KVFSDFAKDQQKYSDLSPLPTPVFFFGQEPGEEFAVEIEKGKTLIIKFLTVSEPHSDGTR
TVFFELNGQPRDVTIVDNSLEGDSLAALKADPTNPKHVGASMPGMIVSIAVNPGDTVKKG
QKLFSLEAMKMESTINAETDGTVAQVHIKPGNQVQTGDLVVTFE
NT seq 3555 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcggtttgccaattcggaacagatcaactatcgtttgcgttagtgcgtacggaa
cgctgcaaggtcacttgtgccagcgataagtcgttggagagagaggaattgatgaagccg
atcaagaagctgttggttgccaatcgcggcgaaattgcaattcgtattttccgttctgcc
acagaacttggcatccgcacggtcgccatttattcctatgaagatcgttatgctttgcat
cgctttaaagccgacgaagcgtatcagatcggcaaagaaggcgagccgattcggacctac
ctgaatatcgatcagattatcgaacaggcggtcgaatgcggcgtcgatgcgatccacccc
ggctacggtttcctttccgaaaacccggatctggcccgcgcctgcgagaaagcgggcatt
gtgttcgtcgggccatccgtcgaatcactcgaacaattgggcgataaaacaaccgctcgc
caattggccgaaaaagcgggtgtgccggtgctttccggcagcggagccgctcttgtttca
gccgaagaaggactgaaacaggccgaagaactgggatacccggtcattctgaaagccgcc
aaaggaggcgggggccgcgggatgcgtgtcgtccgcagcgaagacgaactcgtgcccgcc
ttcgaatctgcccagcacgaagcgaaaaccgccttcggtagcggcgatgtcttcattgaa
aagttcatcgaacgcgcccggcatatcgaagtgcagatccttggcgatcagcacggcaac
ctgactcacctgttcgagcgtgactgctcagtgcagcgtcgtcaccagaaggttgtcgaa
atggccccggcgccgaagctgtccgacaaggcccgcaagacgctgctcgaatctgctctg
gccatcggcaaggtcgtcaactatcacgctgcaggaaccgtggagttcctcgttgatgcg
gccacggaagaggtctacttcatcgaagtgaacccgcgaattcaggtcgaacacaccgtg
actgaagaagtcactggagtggacatcgtgaaaacacagattcaggtctcgtccggcctg
aaactgaccgatccggaaatcggcatcgacccggacaatccgccgcagccaaacggcttt
gcgattcaatgtcgtattacaacggaagacccggccaacaagtttaccccggactacggc
cgcgtctctcactaccggtcagccagcggaatgggcattcgtctcgacgccggttctgcg
ttctcaggtgcggtcgtcaacccgttctacgattcgctgctggtgaaggtaaccgcccac
ggccggaactttgccgagacatcgcggcgaatactgcggagtctgcaggaattccgtatt
cgtggcgtgaaaacgaacattccgttcctgaccaaagtggttacgcatccgactttccag
gccggcgaatgtacaactcgcttcatcgatcagacgccggaactgttcgaattcccgctg
cgtcagaaccgggcgacaaaaatcctgacctacattggcgaaaccatcgtcaacggcaac
ccgctggtcaaagatcgtcccaaagctgcccgtcgcgatccagccccgctgccggaaatt
ccagccgggctggagttgcccaagggaacgcgagataagtttctggaactgggagctgcg
gacttttcgaagtggatcaaagaccagaagcgtctgatgctgaccgataccacgttccgc
gatgctcaccagtcgctgcacgccactcggttccgtacctatgacctgctgaatatcgca
gaaacctattcgtatctctgtccgaatctgttctcactggagatgtggggcggggcgacc
ttcgataccagcatgcgattcctcaaagaatcgccctggcagcgattggcagacattcgc
gaaaaagtgccgaatattctcacgcagatgctgctgcgtgcctcgaacgcggtcggttac
accaactaccccgacaacgtcgtggtggcgtttgtgaaagaagccgcccagacggggatg
gatgtcttccgcgtgttcgacgccctgaactggacgccgaacatgaagctggccatggaa
gcggtgatcgacaccggcatgatctgcgaagcgtcgatctgctacaccggcgacattctc
gatcctaaacggacgaaatacgatctgaagtattacgtcaatctggccaaagagctggag
aaaatgggcgctcacattctggccattaaagacatggccggcctgtgtaaacccgatgcc
gctgctctgctggtgcggacgttgaagcaggaagttgatctgccgattcacttccacacg
cacgacactgcgggaattcaggcagctgcaatcttcaatgctgccaaagaggatctggac
attgccgacggggcaatggctccgatgtcgggcggaacgtctcaaccgaacctgaatacg
gttgtcggagcgttgcagttctccgatcgcaatccggatctcaactccgatgctctcgac
gacattgccacctactggcgggctgtgcgtgaattctatgcaccgttcgaaagtgcggtt
ctgccggccacgtccgacttgtacaaacacgaaatgcccggcggccagtatacgaacctg
ttcgaacaggctcgggcgctcgggttgtccgatcgctgggcagaagtctgcgatatttac
gccgacgtgaaccagttgttcggcgatattgtgaaagtgacaccgacttcgaagtccgtt
ggcgatatggctttgttcatggtcgctaatgatttgaccgcagtggacatcatggacaag
agccgggagctcgcgttcccagcttctgtgatcgacctcattggcggaatgatgggacag
ccacccggtgggttcccggaagagatcaagaaaatcgttctcaaagacaaagaaggtctg
acggatcgcccgggagccagcctgcctccggccgactgggatcaggcgacgaaagacgta
gcaggcctgctgggccgcgaaccgagcaacgccgaggttgtttcgtacctgctgtatccg
aaagtcttctccgacttcgcgaaagatcagcagaagtactccgacctcagcccgctcccc
acgccggtcttcttctttggtcaggagccgggcgaagagttcgccgttgagatcgaaaaa
ggaaagaccctgatcatcaaattcctgactgtgtctgaaccgcacagcgacggaacgcga
acagtcttcttcgaactgaatggtcaaccgcgtgatgtcaccattgtcgacaactcgctc
gaaggcgattcgctggctgccttgaaagccgatccgacaaacccgaaacacgtcggtgcg
agtatgccggggatgattgtttccattgcagtcaacccgggtgacacggtgaagaagggg
cagaaactcttcagcctcgaagcgatgaaaatggaaagtacgattaacgccgagaccgac
ggaactgtcgcgcaggtgcatattaaacccgggaatcaggtgcaaacaggcgatcttgtg
gtaacctttgaatag

DBGET integrated database retrieval system