KEGG   Fermentimonas caenicola: ING2E5B_1333Help
Entry
ING2E5B_1333      CDS       T03818                                 

Gene name
fhs
Definition
(GenBank) Formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
pbt  Fermentimonas caenicola
Pathway
pbt00670  One carbon pool by folate
pbt01100  Metabolic pathways
pbt01120  Microbial metabolism in diverse environments
pbt01200  Carbon metabolism
Module
pbt_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:pbt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ING2E5B_1333 (fhs)
Enzymes [BR:pbt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     ING2E5B_1333 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA ParA AAA_26 AAA_31 ArsA_ATPase ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CEA16083
UniProt: A0A098C0Z9
Position
chrI:complement(1459609..1461273)
Genome map
AA seq 554 aa AA seqDB search
MKSDIQIARETRLKRIKDVAEGIGIPRDEVINFGRHMAKIPVELINMEKVDQSNLILVTA
ITPTKAGVGKTTVSIGLALGLNKIGKNAIVALREPSLGPVFGMKGGAAGGGYAQVLPMEN
INLHFTGDFHAVTTAHNTIAALLENYNFRVQGTGDALKQILWKRVLDVNDRSLRYIVTGL
GPGNGIPQEAGFDITAASELMAILCLSEDEDDLRRRIENILLGYKQNGEPFTVKDLGVAG
AITVLMKDAIHPNLVQTTENTPAFIHGGPFANIAHGCNSVIATKMAMTFGDYVITEAGFG
ADLGAEKFFNIKCRKSGLRPKLSVIVVTAQGLKMHGGTPEKDIKAPDLNGLQKGLGNLEK
HLSNLASFGQSVVVAFNKYAFDTEEEIDAVRKFCEDRGVSFAVNEAFTKGGDGAIELAEK
VVEAIEKRPSGELKFTYSDKDDIETKINKIAKHIYGAQDVVLSETAIKKLKMIQNTNLEK
MPVCIAKTQYSFSADPNWYGVAKDFRLKINDLVINQGSEFIVAIAGQMMRMPGLPADPQA
KRIDIVNGEIEGLS
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcggatattcaaattgcaagagaaacgcgtctgaaacgtattaaagatgtggca
gaaggaataggtattccacgtgacgaagtgattaattttggcaggcatatggcaaagatt
cctgttgaattgattaatatggagaaggtggatcaaagtaacctaattcttgttacagct
ataacgcctaccaaagcaggcgtagggaaaacaacagtttcaataggtttagccttaggg
ttaaacaaaatagggaaaaatgcaattgttgctttgcgtgagccatcactgggaccggtt
tttgggatgaaaggcggtgctgcaggtggcggatatgcgcaagtactaccaatggaaaat
atcaatcttcacttcacaggtgattttcatgctgttactactgcacataatactattgct
gcattgcttgagaactataattttcgtgttcagggaacaggcgatgccttaaagcagata
ttgtggaaaagggtgctggatgttaatgaccgcagcttgaggtatattgttaccggactg
ggaccgggaaatggaattccacaagaggcagggtttgatatcacagcggcatctgaactt
atggcgatcctttgtctatcagaggatgaggatgatttgagaagacgaatagaaaatatt
ctgttaggttataagcaaaatggcgagccttttacagttaaggatcttggtgttgcaggc
gctataactgttctaatgaaagatgctatacatccaaatttagttcaaactacagaaaac
actccggcttttattcatggtggtccttttgcaaatatcgcccatggctgtaactctgtt
atagcaaccaaaatggcaatgacctttggtgactatgttattactgaggcaggttttggg
gcagatctgggagctgagaagtttttcaatataaagtgtcgtaagagtgggttgcgacca
aaattatctgttatagttgttactgctcagggtcttaaaatgcatggtggaactcctgaa
aaggatatcaaggctccagatttgaatgggctgcaaaaaggactaggtaaccttgaaaag
catttgagcaatctggcctcttttgggcaatcggtagttgttgcttttaacaaatatgct
ttcgatacagaggaggagattgatgctgttcgtaagttttgtgaggatcgcggagtctca
tttgctgtaaacgaggcatttactaagggaggtgatggtgccattgaactagcagaaaag
gtggttgaagcaattgagaaaaggccttcgggtgaattgaaatttacctatagtgataaa
gatgacattgaaacaaagatcaataaaattgctaaacatatatatggtgctcaagatgtg
gttttaagtgagactgcaattaagaagctcaagatgattcagaatacgaatctggaaaaa
atgcctgtatgtatagcaaaaacacaatactctttttctgcagatcctaactggtatggt
gtggctaaggattttcgactgaagattaatgacttggtaataaatcagggatctgaattt
atagttgcaatagcaggtcagatgatgcgtatgcctggtctgccggctgatccgcaagct
aaacgtattgatatagttaatggagaaattgagggtttaagctga

DBGET integrated database retrieval system