KEGG   Sedimentisphaera cyanobacteriorum L21-RPul-D3: L21SP3_01264Help
Entry
L21SP3_01264      CDS       T04695                                 

Gene name
hldD
Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
pbu  Sedimentisphaera cyanobacteriorum L21-RPul-D3
Pathway
pbu00540  Lipopolysaccharide biosynthesis
pbu01100  Metabolic pathways
Module
pbu_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:pbu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    L21SP3_01264 (hldD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pbu01005]
    L21SP3_01264 (hldD)
Enzymes [BR:pbu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     L21SP3_01264 (hldD)
Lipopolysaccharide biosynthesis proteins [BR:pbu01005]
 Unusual sugar
  L21SP3_01264 (hldD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AQQ09459
UniProt: A0A1Q2HPR5
Position
1579320..1580300
Genome map
AA seq 326 aa AA seqDB search
MIAVTGAAGFIGSCLIAELNRRGVEDILAIDELGCDEKWKNLRQLKIKDYIEKDDFLSLI
LDDDISLRKNISAVLHMGACSSTTETNCSYLINNNFKYSKILCKWAIENAVRFVYASSAA
TYGSGASGFSDEHSLLNSLEPLNMYGYSKHLFDKWALAGGALNFIAGFKYFNVFGPNEYH
KGSMRSFVLKAYEQIRDTGKVRLFKSESPDYGHGEQLRDFVYVKDVTAMTLFALERRNVN
GIFNAGTGEAKSWNRLAKAVFSAMNKEPEIEYIDMPDHLKGKYQYYTKADMRKLRNAGYN
NDTAEFEEAVRDCVQNYLQKGNYYHS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgatagcagtaacaggcgccgcaggatttataggttcctgccttatagcagagctcaac
agacggggcgttgaggacattttagctatagatgaattgggctgtgatgaaaaatggaaa
aatctcaggcaactcaaaataaaagattatatagaaaaggacgatttcttaagtcttatt
cttgatgatgatatttctttacggaaaaacatatcggctgttttgcatatgggtgcttgt
tccagcacaacagaaaccaactgctcctatttgataaataacaatttcaaatacagcaaa
attctttgcaaatgggcgatagaaaatgctgtccgttttgtatatgcctccagcgctgcc
acttacggcagcggggcaagcggtttcagcgatgaacacagcctgctgaattcccttgag
ccgctgaatatgtacggctattctaaacacctatttgataagtgggctcttgccggagga
gcactgaactttatagcaggatttaaatactttaatgtattcggcccaaacgaataccat
aagggctctatgagaagctttgttttgaaggcctatgagcagataagggataccggcaag
gttcggcttttcaaaagcgaaagccccgattacggccacggcgagcagcttagagacttc
gtttacgtaaaagacgtaactgctatgacacttttcgcactggaacgcaggaacgtaaac
gggatattcaatgcaggcactggggaggcaaagagctggaacaggctagccaaggcggtg
ttttccgcaatgaacaaagagccagaaattgaatacattgatatgccggatcatctaaaa
ggcaaatatcagtattatactaaggctgatatgagaaaactcagaaatgccggctacaat
aatgatactgccgaatttgaagaggctgtaagagactgcgtacaaaattaccttcagaaa
gggaactattatcacagctaa

DBGET integrated database retrieval system