KEGG   Paenibacillus bovis: AR543_02410Help
Entry
AR543_02410       CDS       T04407                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
pbv  Paenibacillus bovis
Pathway
pbv00020  Citrate cycle (TCA cycle)
pbv00620  Pyruvate metabolism
pbv01100  Metabolic pathways
pbv01110  Biosynthesis of secondary metabolites
pbv01120  Microbial metabolism in diverse environments
pbv01130  Biosynthesis of antibiotics
pbv01200  Carbon metabolism
Module
pbv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pbv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AR543_02410
   00620 Pyruvate metabolism
    AR543_02410
Enzymes [BR:pbv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     AR543_02410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO HI0933_like Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ANF94996
UniProt: A0A172ZBG8
Position
complement(566705..568255)
Genome map
AA seq 516 aa AA seqDB search
MSSIQKKTDIILIGAGVMSATLGSLLKELAPEWEIKVFEKLASAGEESSNEWNNAGTGHA
ALCELNYTTEKPDGSVDISKAVQINEQFQLSRQFWSFLVKSNLIRNPQDFIKPIPHMSLV
MGEKNVSFLNKRFKALSKLPLFEGMEYSDDPNKLKKWIPLIMEGRSSNEPIAATKIDSGT
DVNFGALTRMLFDHLKSKNVEIHYKHSIKDIKRTSDGMWSVKVQNLDNGKVEHHLTKFIF
IGAGGGSLPLLQKTGIPESRYIGGFPVSGLFMVCNNPDIVARHHAKVYGKAKVGAPPMSV
PHLDTRYIGNKKALLFGPFAGFSPKFLKTGSNLDLIGSVKPNNLFTMLAAGAKEMGLTKY
LIQQVMLSNDKRLEELREFIPNAKLDEWEIVVAGQRVQVIKDTPSGKGTLQFGTEVVSAA
DGSVAALLGASPGASTAVHVMLEVLQRCFPQRMNEWEPKIKEMIPSYGIALADHPDMFHE
IFASTTKTLELSEEKHPSIDSLKIVTEPEVFGEPVQ
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcatacagaaaaaaacagacattatcttaattggtgccggggtcatgagtgcg
acgctgggatcattgctgaaagagttagcaccggagtgggaaattaaagtgtttgaaaaa
ctcgcaagcgctggagaagaaagctccaacgaatggaataatgcgggtacaggccatgct
gccctatgcgagctgaactatacgaccgagaagccggacggatcggtagatatcagcaag
gcggtacagatcaatgagcaatttcagctgtcccggcaattctggtccttcctggtgaaa
agcaatctgatccgcaatccacaggactttatcaagcctatccctcatatgagtctggtc
atgggcgagaaaaatgtatcttttctgaacaaaagatttaaagcgctatcaaaactgcca
ttgttcgaaggcatggagtattcggacgatccgaacaaactcaaaaaatggattccgctt
attatggaaggccgctcgtccaatgaaccgattgcggcaaccaagatcgattccggtacg
gacgtgaactttggggcgctaacacgcatgctgttcgaccatctcaaaagcaaaaatgta
gaaattcattataaacatagcatcaaggatatcaagcgtacgagcgatggcatgtggtca
gtcaaagtgcagaatctggataatggtaaagtggagcatcatctgaccaaatttatcttt
atcggtgccggaggcggcagtctgccactgctgcagaaaacaggtattccggaatcgcgt
tatatcggcggattcccggtcagtggcctgttcatggtctgcaacaacccggatatcgtc
gcccgccatcatgccaaagtatacggcaaagccaaagtaggcgcgccgccaatgtcggtt
ccgcatctggatacccgctatatcggcaacaaaaaggcgctgctgttcggtccgttcgcc
ggcttctcgccgaagttcctcaaaacaggctccaacctcgatctgatcggatcggtgaag
ccgaataacctgttcacgatgctggcagccggtgccaaggaaatgggactgaccaagtac
ctgatccagcaggtgatgctgtccaacgacaagcggctggaagagctgcgcgaatttatt
cccaatgccaagctggacgaatgggagattgtggtcgccggtcagcgtgtgcaggtaatc
aaggatactcctagcggcaaaggaactctgcagttcggtacggaagtggtcagtgcggca
gacggctcggtcgctgcactgctgggcgcttctccgggcgcttcgaccgccgtgcacgtt
atgctggaagtactgcaaagatgcttcccgcagcgcatgaacgaatgggagcccaagatc
aaagagatgattccttcctacggcatagcactggcggatcatccggatatgttccatgaa
atcttcgcgtccacaaccaagacactggagctgagcgaagaaaagcaccccagtatcgac
tctctgaaaatagttaccgagccggaggtattcggagaaccggtgcagtag

DBGET integrated database retrieval system