KEGG   Paenibacillus bovis: AR543_10585Help
Entry
AR543_10585       CDS       T04407                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
pbv  Paenibacillus bovis
Pathway
pbv00561  Glycerolipid metabolism
pbv00640  Propanoate metabolism
pbv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AR543_10585
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AR543_10585
Enzymes [BR:pbv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     AR543_10585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase TraG-D_C Xrn1_D3
Motif
Other DBs
NCBI-ProteinID: ANF98749
UniProt: A0A172ZMH3
Position
2491454..2492572
Genome map
AA seq 372 aa AA seqDB search
MTERVFISPGKYVQGRDVIQKTGEYVKGIKGDKSLVIADDIVWDIAGNQVLESLDQSSVS
YIKAVFNGEASTNEINRLVEIGRENNATIVIGVGGGKTLDTAKAVSDTLGGYTVIIPTTA
STDAPTSALSVIYSDEGIFESYKFYNKNPDLILVDTKIIASAPPRFLSSGIADALATWVE
ARAVIEARATTMAGGLPTLAAEAIARKCEETLFDFGLLAYESVQRKVVTSAVEAVVEANT
LLSGLGFESGGLAGAHAIHNGFTVLEGDIHHMTHGEKVAFGTLTQLALEKRPIQEIERYI
EFYISLDLPVTLEDLKIANVSDEDLYRVAQAATKPDETSHNLPFKVTADDVKDAIIAADQ
YSHAYKTKKGHK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacgcgtatttatcagtcccggcaaatatgtacagggcagagacgtcatccag
aaaacaggtgagtatgtaaaagggatcaagggagacaaatcgctcgttatcgccgatgat
attgtgtgggatatcgcaggcaaccaggtactggaaagtctggatcagtcatctgtgagc
tacatcaaagcagtcttcaacggagaagcatcgactaatgaaattaaccgtctggtagag
attggccgagagaacaacgctacgattgtgatcggagtaggcggcggcaaaacgctagat
acagccaaagcggtcagtgatacacttggcggctacacggtgattatcccgactacagcc
tctacagatgcaccaaccagtgcattatccgttatttattcggatgaaggtatattcgag
agctacaaattttataataaaaatccggatctgattctggtagataccaagattatcgcg
agtgcaccgccacgcttcctgtcttctggtatagcggatgccttggcaacctgggtagag
gcacgcgctgtaatcgaggcacgtgccacgacgatggctggcggactgcctacactggct
gctgaagcgattgcgcgcaaatgtgaagagacgctgtttgactttggtctgctggcatac
gagtcggtacagcgcaaagtggtaacatctgccgtagaagcagtcgttgaagccaatacg
ctgctcagcggtctgggctttgaaagtggcggtctggcaggagcacatgcgatccataac
ggcttcactgtactcgaaggcgatattcaccatatgacacatggagaaaaagttgctttt
ggtacattgacccagctggcattggagaagcggcctattcaggaaatcgagcgttatatt
gaattttatatcagtctggatctgccggtaacgttggaagatctcaaaattgccaatgta
tccgatgaggatctgtaccgtgtagcacaggcagcgaccaagccagatgagacatcgcat
aatctgccgttcaaagtaaccgccgatgatgttaaggatgccattatcgcagccgatcaa
tattcccacgcatacaaaaccaaaaaaggtcacaaataa

DBGET integrated database retrieval system