KEGG   Paenibacillus bovis: AR543_12310Help
Entry
AR543_12310       CDS       T04407                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pbv  Paenibacillus bovis
Pathway
pbv00010  Glycolysis / Gluconeogenesis
pbv00053  Ascorbate and aldarate metabolism
pbv00071  Fatty acid degradation
pbv00280  Valine, leucine and isoleucine degradation
pbv00310  Lysine degradation
pbv00330  Arginine and proline metabolism
pbv00340  Histidine metabolism
pbv00380  Tryptophan metabolism
pbv00410  beta-Alanine metabolism
pbv00561  Glycerolipid metabolism
pbv00620  Pyruvate metabolism
pbv00625  Chloroalkane and chloroalkene degradation
pbv01100  Metabolic pathways
pbv01110  Biosynthesis of secondary metabolites
pbv01120  Microbial metabolism in diverse environments
pbv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pbv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AR543_12310
   00053 Ascorbate and aldarate metabolism
    AR543_12310
   00620 Pyruvate metabolism
    AR543_12310
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AR543_12310
   00561 Glycerolipid metabolism
    AR543_12310
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AR543_12310
   00310 Lysine degradation
    AR543_12310
   00330 Arginine and proline metabolism
    AR543_12310
   00340 Histidine metabolism
    AR543_12310
   00380 Tryptophan metabolism
    AR543_12310
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AR543_12310
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AR543_12310
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AR543_12310
Enzymes [BR:pbv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AR543_12310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ANF96715
UniProt: A0A172ZGD6
Position
2879084..2880550
Genome map
AA seq 488 aa AA seqDB search
MTLVQSKFAKWNKQFIAGEWTEGTSDKTIKNINPYNGELLVEMKASSQDDLDRAYETAYK
AGKEWAKVPLGVRAQVIYKALAQMDERKEEIIELLIAEAGSTRIKAEREWTAARRIMEES
ASFPYRMKGDIMGSDIPGKENRVVREAKGVVGMIGPWNFPLHLCMRTVAPALALGNGVVI
KPASDTPITAGLLIADIFDQAGLPKGVLSVVSGSGSEIGDAFVAHPIPKIISFTGSTEVG
KGIGKLAGEHLKEVALELGGDNAMIVLDDADIDRAVEAAVFGKFFHQGQICMALNRIIVD
DSIYDTFTDKFVAKVKTLQFGDPSDPKTIVGPLIHEKEAERLLDVVEQAQKAGAKLLYGG
KANGSVLEPTVLSEVAADNPAAQKELFGPVALLIRAKGEEDALRIMNSSEYGLSGSVFTT
NLERGYQVAQQMETGMIHVNDQSVNDEAHVMFGGEKASGVGRFGGEWAIEKFTRTRWISI
QHQYRDFF
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgtacaatccaaatttgctaaatggaacaaacaatttattgctggtgaatgg
accgaaggtacctctgataaaacaatcaaaaatataaatccatacaatggcgagctgctc
gtcgaaatgaaagcttccagccaggacgatctggaccgtgcttatgagacagcctacaaa
gcaggcaaagaatgggccaaagtaccactcggtgtccgtgcacaggtgatctacaaagca
ctggcgcaaatggatgaacgaaaagaagaaatcatcgaactgctgattgccgaggcaggc
agcacccgaatcaaggcagagcgcgaatggacagctgcgcgccgtattatggaagaatcg
gcttctttcccataccggatgaaaggcgatattatgggctccgatattccgggcaaagaa
aaccgtgtcgttcgtgaagccaaaggcgtggttggcatgatcggcccgtggaacttcccg
ctgcatctgtgtatgcgtacggtagctcctgcactggcgcttggtaatggcgtggtaatc
aagccagcttccgatacgcctattacagccggtctgttgatcgctgatatttttgaccag
gcaggacttcccaaaggtgtactcagcgtcgtaagcggtagcggcagcgagatcggcgat
gcttttgtcgcacatcctattcccaaaatcatttcctttaccggttctacagaagtaggc
aaaggaatcggcaaattggctggcgaacatctgaaggaagtagcacttgagctaggtgga
gacaatgcgatgatcgtactggatgatgcagatattgaccgcgctgtcgaagcagccgta
ttcggcaagtttttccaccagggccaaatctgtatggcgttgaaccggattatcgtggat
gactctatctatgatacgtttacggacaaattcgtggccaaagtcaaaacacttcaattc
ggcgatccttccgatccgaaaacgattgttgggccgttgatccatgaaaaagaagccgag
cgtctgctggacgttgtagaacaggcacaaaaagccggagccaagctgctatacggcggc
aaagcgaacggcagtgtgctggagcctacggtactgagtgaagtggcggctgataatccg
gctgcccaaaaagagctgttcggtccggtagccttgctgattcgtgccaaaggggaagag
gatgctttgcgtattatgaacagcagtgaatatggactaagcggttcagtatttactacc
aatctggaacgtggctaccaggtcgcacagcagatggagacaggtatgatccatgtcaat
gatcaatctgttaacgatgaagcccatgttatgttcgggggcgagaaagcttccggcgta
ggtcgttttggtggtgaatgggcgatcgagaaattcacacgtacccgctggatcagtatt
cagcatcaataccgcgatttcttctaa

DBGET integrated database retrieval system