KEGG   Paenibacillus bovis: AR543_17060Help
Entry
AR543_17060       CDS       T04407                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pbv  Paenibacillus bovis
Pathway
pbv00010  Glycolysis / Gluconeogenesis
pbv00071  Fatty acid degradation
pbv00350  Tyrosine metabolism
pbv00620  Pyruvate metabolism
pbv00625  Chloroalkane and chloroalkene degradation
pbv00626  Naphthalene degradation
pbv00650  Butanoate metabolism
pbv01100  Metabolic pathways
pbv01110  Biosynthesis of secondary metabolites
pbv01120  Microbial metabolism in diverse environments
pbv01130  Biosynthesis of antibiotics
pbv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pbv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AR543_17060
   00620 Pyruvate metabolism
    AR543_17060
   00650 Butanoate metabolism
    AR543_17060
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AR543_17060
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AR543_17060
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AR543_17060
   00626 Naphthalene degradation
    AR543_17060
Enzymes [BR:pbv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AR543_17060
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AR543_17060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ANF97547
UniProt: A0A172ZJV3
Position
complement(4032664..4035276)
Genome map
AA seq 870 aa AA seqDB search
MAVKNDATRTVEVTAQEEIQRMIDKANKAQAAFMKMNQEQIDEVVQAMALAGLDKHMYLA
KLAVEETGRGVYEDKITKNIFATEYIYHSIKNEKTVGIIEDNAYDNFQKIAEPVGTIMGI
TPVTNPTSTTMFKALIAIKTRNPIIFGFHPSAQQCSKEAARILLEAAVKHGAPADCIQWI
DNPSMDKTNALMNHPDVALILATGGGAMVKAAYSCGKPALGVGPGNVPAFIEKSADLKQA
VTDLILSKSFDNGMICASEQAVIIEEPVFEQVKKLMIDNGCYFLSKEEVGKLTAGAMNVE
KCAVNPAIVGQPATKIAEMSGITVPAGTKILVAELEGVGTKYPLSAEKLSPVLACYKVKT
AEQGIERAAQIVEFGGMGHSSAIHSNNDEVIQKFADRLQTGRIIVNSPSTHGAIGDIYNT
NLPSLTLGCGSYGRNSTSSNVTAVNLINVKRVARRTVNMQWFKIPSKVYFEKGSTQYLAK
MPNISRVIIVTDPMMVQLGYVEKVEHYLRQRQTPVAIEVFSDVEPDPSTTTVERGRQMME
RFQPDCIIALGGGSPMDAAKGMWLFYEYPDVEFDNLKQKFMDIRKRIYKYPHLGQKAQFV
AIPTTSGTGSEVTSFAVITDKEKGNTKYPLADYELTPDVAIVDPEFVYSLPRVAVADTGM
DVLTHAIEAYVSNMANDYTDGLAIKAIQLVFQYLEQSALQGDKLAREKMHNASTIAGMAF
ANAFLGINHSLAHKWGGQYHTAHGRTNAILMPHVIRYNAKKPTKFASFPKYSHFIADERY
AEIARILGLPARTTEEGVTSLINAIRDLNRKLGIPESFEALGFDAKDFEAHVDYLADRAF
EDQCTTANPKMPLVTELADVYRNAFYGKFE
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggctgttaaaaatgatgccactcgcaccgtagaagttactgcacaggaagaaattcaa
agaatgattgacaaagcgaacaaagcacaagccgcatttatgaaaatgaatcaggaacaa
attgatgaagttgtacaggctatggcacttgccggactggacaaacatatgtatctcgcc
aagctggctgttgaagaaacaggcagaggggtatatgaagacaaaatcaccaaaaacatc
tttgcgactgaatatatatatcacagcatcaaaaacgaaaaaacagttggtatcattgaa
gacaatgcatacgacaacttccagaaaatcgctgaaccggttggtacgatcatggggatc
actcctgtaaccaacccaacatcgactaccatgttcaaagcactgatcgccatcaaaacg
cgtaacccgattatcttcggtttccacccatctgcacagcaatgtagtaaggaagctgca
agaatcctgctcgaagcagctgtcaaacatggcgctcctgcagattgtatccagtggatc
gataatccttccatggacaaaacgaatgcactgatgaatcatcctgatgttgcattgatc
ctcgctactggcggcggcgcaatggtcaaagcggcttacagctgtggtaaacctgcactc
ggcgtaggtcctggtaacgtacctgcctttattgagaaaagtgcagacctcaaacaagcg
gtaaccgacttgattctgtccaaatcgtttgacaacggtatgatctgtgcatccgaacaa
gctgtgatcatcgaagaacccgtattcgagcaagtgaaaaaactgatgatcgacaacggt
tgctacttcctgagtaaagaagaagtaggcaaactgactgcaggtgccatgaatgtagag
aaatgtgcagtcaatccggcaatcgtcggtcaaccagcaaccaaaatcgctgaaatgagc
ggtatcactgttccagcaggcaccaaaattctggtcgctgaactggaaggtgtaggaacc
aaatatccattgtccgctgaaaaactcagtcctgtactggcttgttacaaagtgaagacg
gcagaacaaggtatcgaacgtgctgcacaaattgtagaattcggtggtatgggtcactct
tcggctatccattccaacaatgatgaagtgatccagaagttcgcagatcgtctgcaaacc
ggacgtatcatcgtgaattcaccttcgacacatggcgccatcggcgacatttacaatacg
aacctgccttccctgacactgggctgcggatcgtatggccgtaactcgacatcttccaat
gtaacagcagtcaatctgattaacgtgaaaagggtggcgcgtcgtaccgtgaatatgcaa
tggttcaagattccttccaaagtgtactttgaaaaaggttcgactcaatacctggccaaa
atgccaaacatcagccgcgttatcatcgttactgacccaatgatggtacaactgggctat
gtcgaaaaagtagaacattacctgcgtcaacgtcagacaccggtagcgatcgaagtattc
tccgatgtagagccggatccatcgacaactacagtagaacgcggccgtcaaatgatggaa
cgcttccagcctgactgcattatcgcactcggtggcggatcaccaatggatgctgccaaa
ggcatgtggctgttctacgaatatcctgatgtagaatttgacaacctgaaacaaaaattc
atggatatccgcaaacggatctacaaatacccgcatctgggacaaaaagcgcaattcgta
gcgattcctactacttcgggtacaggttcggaagttacctcgttcgcggttattacagac
aaagaaaaaggcaataccaaataccctctggcagactatgagctgactccggacgtagcg
attgtagaccctgaatttgtctactccctgccacgtgtagctgtagccgataccggtatg
gatgtactaactcatgcgattgaagcctatgtatcgaatatggcaaatgactacactgat
ggtctggcgatcaaagcgatccaattggtcttccaatacctggaacagtcggcactgcaa
ggcgacaaactggctcgtgaaaaaatgcataatgcttcgacgatagccggtatggccttt
gccaacgcattcctgggcatcaaccacagtctggcacacaaatggggcggacaataccat
acagcacatggacgtaccaacgcgatcctgatgccgcatgttatccgctacaatgcgaaa
aaacctaccaaattcgcatcgttccctaaatactcgcactttatcgctgacgaacgttac
gctgaaattgcccgtatcctgggactgccggcacgtactaccgaagaaggtgtaaccagc
ctgatcaacgcaattcgcgatctgaaccgcaaactgggtatccctgaatcgttcgaagca
ctgggctttgatgccaaagactttgaagcacatgtcgattacctggctgaccgtgcattt
gaagaccaatgtacaactgccaatcctaaaatgccgctggtaaccgaactggctgatgta
taccgtaacgctttctacggtaaatttgagtaa

DBGET integrated database retrieval system