KEGG   Paenibacillus bovis: AR543_21925Help
Entry
AR543_21925       CDS       T04407                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pbv  Paenibacillus bovis
Pathway
pbv03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pbv00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AR543_21925
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pbv03011]
    AR543_21925
Ribosome [BR:pbv03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AR543_21925
  Bacteria
    AR543_21925
  Archaea
    AR543_21925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ANF98380
UniProt: A0A172ZMN0
Position
complement(5134094..5134441)
Genome map
AA seq 115 aa AA seqDB search
MQAKAHAKFVRIAPRKVQLVVDLIRGKQVGEAIAILRHTPKSASPVVEKLLNSAIANAEF
ISTEKNESLDVNNLFISEAFVNQGPTLKRFRPRAMGRASKINKRTSHISLVVTEK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgaaagcacatgcaaagtttgtacgcatcgctccgcgcaaagttcaactggtt
gttgacctgatccgcggaaagcaggttggtgaggcgatcgcaattctgcgtcacacacca
aaatctgcatctccggtagttgagaagcttcttaactccgcaatcgccaatgctgaattc
atcagcactgagaaaaacgaatctctggacgtgaacaacctgttcatttctgaagctttc
gttaaccaaggtcctactttgaaacggttccgccctcgtgcaatgggacgtgcaagtaag
atcaacaaacgcaccagccacatttctttggtggtaactgaaaaataa

DBGET integrated database retrieval system