KEGG   Pseudoalteromonas sp. Bsw20308: D172_003160Help
Entry
D172_003160       CDS       T04175                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
pbw  Pseudoalteromonas sp. Bsw20308
Pathway
pbw00564  Glycerophospholipid metabolism
pbw01100  Metabolic pathways
pbw01110  Biosynthesis of secondary metabolites
Module
pbw_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:pbw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    D172_003160
Enzymes [BR:pbw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     D172_003160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ALQ09683
Position
complement(736029..736856)
Genome map
AA seq 275 aa AA seqDB search
MPKHFISRVVGKLAAAKAGALTTTLIKLFIKQYKVDMSEAQYPDPAHYKSFNEFFTRPLK
DGMRPMVEDSNIITHPVDGAISQLGDIVDGQLIQAKGHDYSLQALLGGSQDDTTPFLGGK
FATIYLAPKDYHRIHMPIDGTLSKMIYVPGDLFSVNPLTAQNVPNLFARNERVVAIFETE
IGPLAMVLVGATIVASIETIWAGTVTPPAGSDVFSWKYPTTGDNAITLKKGEEMGRFKLG
STVVLAWGADKAEILDDQLPEVVTRLGTAFAKIND
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacattttatttcacgcgtagtgggaaaattagccgcagctaaagcaggtgct
ttaacaacgactttaattaaactatttattaagcaatataaagtagatatgagcgaagcc
caatacccagatcctgctcattataaaagctttaatgaattttttactcgccctctaaaa
gacggcatgcgcccaatggtagaagatagcaatatcatcactcatccagtggatggcgca
atcagccagctaggcgatattgttgacggacagctaatacaagctaaaggtcacgattac
agcttacaagcgctactaggcggctcacaagatgatacaacaccatttttaggcggtaag
tttgccactatttatttagcacctaaagattaccaccgtattcatatgccaattgatggc
acactaagcaaaatgatttacgtgccaggtgatttattttcagtaaacccacttacagcg
caaaacgtgcctaacttgtttgcacgtaatgaacgagtagtcgcaatttttgaaactgag
attggtccgcttgctatggtacttgttggcgcaacaattgtagccagcatagaaactatt
tgggcaggtactgtcacgccaccagctggtagcgatgtatttagttggaaatacccaacc
actggcgataacgctatcacgcttaaaaagggtgaagaaatgggtcgctttaaattaggc
tctactgtggtacttgcatggggtgctgataaggctgaaatactggacgatcaactacca
gaagtggttactcgcttaggtactgcgtttgcaaaaattaacgactaa

DBGET integrated database retrieval system