KEGG   Pseudoalteromonas sp. Bsw20308: D172_004310Help
Entry
D172_004310       CDS       T04175                                 

Definition
(GenBank) glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
pbw  Pseudoalteromonas sp. Bsw20308
Pathway
pbw00860  Porphyrin and chlorophyll metabolism
pbw00970  Aminoacyl-tRNA biosynthesis
pbw01100  Metabolic pathways
pbw01110  Biosynthesis of secondary metabolites
pbw01120  Microbial metabolism in diverse environments
Module
pbw_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pbw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    D172_004310
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D172_004310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pbw01007]
    D172_004310
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pbw03016]
    D172_004310
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:pbw02048]
    D172_004310
Enzymes [BR:pbw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     D172_004310
Amino acid related enzymes [BR:pbw01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   D172_004310
Transfer RNA biogenesis [BR:pbw03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    D172_004310
 Prokaryotic Type
   Other AARSs
    D172_004310
Prokaryotic defense system [BR:pbw02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    D172_004310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ALQ07354
Position
995036..996520
Genome map
AA seq 494 aa AA seqDB search
MTIRTRVAPSPTGDPHLGTAYIALFNYCFAKQQGGEFVLRIEDTDQVRSTPESELAIMDS
LRWLGLEWDHGPDVGGEFGPYRQSERSDLYKKYAHQLVDDGKAFYCFATSEELDQMREEQ
MAEGLRPKYDGRGLNYTDEEIKANLAAGKPYVIRMKIPSEGTFKFNDYLRDEIEIPWENV
DMQVLLKADGFPTYFLANVVDDHHMQISHIFRGEEWINSAPKLLKLYEDFGWEAPVLGHL
PLLRNPDKSKLSKRKNPTSINYYKEMGYLPEAVLNYLGRMGWSMPDEREKFTLNEMIENF
DMKRVSLGGPVFDVDKLSWLNGMWIRENLTDEQLIQRFVDWKFNGEMLAKILPEVKTRIN
TLSDMVELAGHFVGGIPTYDPALLTAGKADENVIRQALQFFVWQLEGLRSFEKPAIFAIA
KEVATFHELKIKDFLEPIFVAITGKTSSTSVLDAMEILGSDLSRARLRVALAHLGISKKQ
AKNIERAYREYPSA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacaattcgcacccgtgttgccccgtcgccaactggtgacccgcatcttggcaccgct
tatatcgccttatttaactactgttttgctaaacaacaaggcggtgaatttgtacttcgt
atagaagatacagaccaagtacgtagcacgccagagtctgaacttgcgattatggatagc
ctacgttggttagggcttgagtgggatcatggtcctgatgtgggtggcgaatttggtcct
taccgtcaatctgagcgtagcgatttatataaaaaatacgcgcatcagttagttgacgat
ggcaaagcgttttactgctttgcaacaagcgaagagcttgatcaaatgcgtgaagagcaa
atggcagaaggcttgcgccctaaatacgacggtcgtggtttaaactacacagatgaagaa
attaaagcaaacttagcggcaggcaaaccttacgttatacgtatgaaaatcccaagcgaa
ggcacatttaagtttaacgactacctacgtgatgaaattgagatcccgtgggaaaacgta
gacatgcaagtgttattaaaagcagatggtttcccaacgtactttttagcgaacgtagtt
gacgaccaccacatgcaaattagccatattttccgtggtgaagaatggattaactcagca
cctaagttattaaaactttacgaagattttggttgggaagcgccagtacttggtcactta
ccattactacgtaacccagataaatcaaagctgtctaagcgtaaaaacccaacatctatt
aattactataaagaaatgggttacctgccagaagccgtacttaactacttaggtcgtatg
ggttggtcaatgcctgatgagcgtgaaaagttcacacttaatgagatgattgaaaacttc
gacatgaagcgcgtatcgcttggtggtccagtattcgacgtagataaattaagctggtta
aacggcatgtggatccgcgaaaacctaaccgacgagcagttaattcagcgctttgttgat
tggaagtttaacggcgaaatgctcgctaaaatattaccagaagttaaaacacgtattaat
acgctgtcggatatggttgagcttgcagggcactttgtaggtggtattccaacttacgat
cctgcgctattaacagccggcaaagcagacgaaaacgtgattcgccaagcgctgcaattt
tttgtatggcagcttgaaggtttacgtagctttgaaaagccagctatttttgcaattgca
aaagaagtggcaacattccacgagcttaaaattaaagactttttagagccaatttttgtc
gcaattacaggcaaaacatcaagtacgtcagtgcttgatgcaatggaaatattggggtct
gacttatcacgtgctcgtttacgtgtagcccttgctcatttaggtatttctaaaaagcag
gctaaaaatatagagcgtgcgtaccgcgaatacccaagtgcataa

DBGET integrated database retrieval system