KEGG   Pseudoalteromonas sp. Bsw20308: D172_005535Help
Entry
D172_005535       CDS       T04175                                 

Gene name
rluD
Definition
(GenBank) 23S rRNA pseudouridylate synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
pbw  Pseudoalteromonas sp. Bsw20308
Brite
KEGG Orthology (KO) [BR:pbw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pbw03009]
    D172_005535 (rluD)
Enzymes [BR:pbw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     D172_005535 (rluD)
Ribosome biogenesis [BR:pbw03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    D172_005535 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 CT47
Motif
Other DBs
NCBI-ProteinID: ALQ07585
Position
1293509..1294486
Genome map
AA seq 325 aa AA seqDB search
MTEQISLQAEVPTDLGGKRLDQVLAQLFPDYSRSRIKTWILDDKITVDGEILNTPRTKLL
GGELLNVETTIEAPREYLAQNIDLNIVYEDDHILVINKPMGLVVHPGAGNPDGTVLNALL
HHYPEIINVPRAGIVHRLDKDTTGLMVVAKTIPAQTHLVTALQKRENFTREYEALCNGTM
TAGGMIEKPIGRHATQRTHMAVHEMGKPAITHYRVAEKFRAHTRLRLRLETGRTHQIRVH
MAYLNHPLIGDQSYGGRPRPPKGATPELFELLRSFRRQALHAVKLSIAHPITGEMMTWQA
PIPDDMVAMTLALREDTKANPDIDR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcaaatttctcttcaagccgaggttccaaccgacttaggtggtaaacgtcta
gaccaagtattagcgcaattgttccctgattattcacgttcacgtataaaaacatggatt
ttggatgataaaattactgttgatggcgaaatattaaacacaccacgtactaagttatta
ggtggtgaacttcttaatgttgaaacaactattgaagcaccgcgagaataccttgcacaa
aacatcgatttgaacatagtttatgaagacgatcatattttggtcatcaataaaccaatg
ggacttgtggtccaccctggggcaggtaatccagatggcacagtattaaatgcgctatta
catcactacccggaaattatcaatgttccgcgagctggtattgtgcacaggttagataag
gatacgacaggattaatggttgtagctaagacgatccctgcacaaacgcatttagtgaca
gcactacaaaaacgtgaaaacttcacccgtgaatatgaagcgctttgtaatggaacgatg
accgctggtggcatgattgaaaagcctattggtcgccatgcgacacagcgtacacacatg
gctgttcatgaaatgggcaaacctgctattacgcattaccgtgtggctgaaaagtttcgc
gcacatactcgcttgcgtttgcgcttagaaaccggtcgtacacaccaaattcgtgttcat
atggcttacttaaatcacccattaattggtgatcagtcttatggcggccgtccgcgtcca
ccaaaaggtgcaactcctgagttatttgagctacttcgtagttttagacgccaagctctc
cacgcggttaaattaagcattgctcatcctattacgggtgaaatgatgacatggcaagcg
cctatacctgatgatatggttgctatgacgctagcactacgcgaagacaccaaagctaat
cctgatatagatagatag

DBGET integrated database retrieval system