KEGG   Pseudoalteromonas sp. Bsw20308: D172_006800Help
Entry
D172_006800       CDS       T04175                                 

Definition
(GenBank) exonuclease V subunit beta
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
pbw  Pseudoalteromonas sp. Bsw20308
Pathway
pbw03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pbw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    D172_006800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pbw03400]
    D172_006800
Enzymes [BR:pbw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     D172_006800
DNA repair and recombination proteins [BR:pbw03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     D172_006800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C UvrD_C_2 PDDEXK_1 ResIII AAA_11
Motif
Other DBs
NCBI-ProteinID: ALQ07784
Position
1574999..1578562
Genome map
AA seq 1187 aa AA seqDB search
MQALNPLTMPLIGQSLIEASAGTGKTYTITGLYLRYLLGMQIEGELNTPLSVEQILVVTF
TDAATQEIKDRVRSRIIAARDALLGQDPNDELIEGVIAKIDDKHRAFDLLDAAAKSMDEA
AIFTIHGFCQRMLKQHAFESGVAFNLEFILDERDILLETIKDFWRAFVYPLNKERTDAIL
DVFAAPEALFAQVASILNKANAHITPQINLDDVWKARDKYITRVPAFKKAVLEQEFIGAI
KSSGLSGSKTPARKGSLGALEAFCLGGDLFFEFGTNKYSFEVWSTENLSDVANYKKNQPL
FVHPLLSQFDELAALNNTINQGLKIAVVQHAARWVKAAIVKRKQEQSVITPDDLLTNLHS
ALNNEQGDVLAQKIAQLFPVAMIDEFQDTDPIQYGIFSKIYGQQNTTLAMIGDPKQAIYG
FRGADIFTYIGAKEAVQSDQQFTLGTNFRSSTDIVNSVNSLFGKHANSFIYNDAIPFNAV
AAKGKKAEDSFLIDGKPATAFEFNVFVDEAADEKNKPTNKGVGQAHLATHFANKIVTLLE
KAKQGDACIGSTPVSAADICILVRDRVEAQIMKKALDDAKISSVYLSRESVFSQELSHHL
LNFLTALHGQYDESLLRGVLAGPLFCLSYNEIHALADDENKWQDYLNFFAQLSHIWNKQG
AMAMLERLMSHNQLSAKWQGLGYNVERWLTDFRHLGEILQQKQIELEGTLRLLRWFAQKV
SQQDGETVQVRLESDANLVKIVTMHASKGLEYPLVFMPFASGYRETKEALYHNNGKLVYD
LSKDEDALQKAEQERLAEDLRLLYVALTRAVHFCALGVYNIGQGQSSRLAMQSSALGHVL
FAGLELASSQTWRTHLSEFCDANSAMSYQQFTSQTLLEQGTLCFNNSESAQQTLSVNKVT
ANIERNWRATSFSALSFKKHSDQLAPGRSDEDHEKDEFAVQEDEIPSPYSFPKGPKPGSC
LHEIFEQIDFISPIVHPTNTEQNLSEVVKRSLEKYHIGEQWQEVAEKWVLDVLACPLNEG
LLSLGVLTPGDCLVEMEFNLPLESLSAPKLNEILIKHFGFAQSKLEFSQVKGLLKGFVDL
IFCYQGKYYILDYKSNYLGSTPADYESDMLEQAMSSHQYHLQYLIYTVALHRLLKQRIAD
YSIETHLGGVYYTFLRGMPAGQGVYFKKLTVEQVIILEGLFSQGAML
NT seq 3564 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgcttaatcctcttactatgccgctcattggtcaaagtttaatagaagccagt
gccggtactggtaaaacttatacaattacggggctgtatttacgttacttactaggcatg
caaatagaaggtgagttaaatacgccgctcagtgttgagcaaattttggtagtaaccttt
accgacgctgccacccaagaaattaaagaccgcgtacgcagccgaattattgctgcgcgc
gacgcattgcttgggcaagacccaaacgacgaacttattgaaggcgtaattgccaaaatt
gatgataagcaccgcgcgtttgatttactcgatgcagctgctaaatcaatggacgaagcc
gctatttttactattcatggcttttgtcagcggatgctaaagcaacatgcgtttgagtcg
ggtgtggcgtttaatctcgaatttattttagatgagcgcgacatattactcgaaactatt
aaagatttttggcgggcatttgtatacccacttaataaagaacgcaccgatgctatttta
gatgtatttgccgcacccgaggctttattcgctcaagtggcgagcattttaaacaaagct
aatgcgcacattacaccacaaataaatttagatgatgtatggaaagcccgtgacaagtac
ataacccgtgtgcctgcatttaaaaaagcggtgttagagcaagagtttatcggtgctatt
aaaagctcgggtttaagcgggtctaaaacgccagcacgaaaaggcagccttggtgcgctt
gaggcattttgtttaggcggcgatttgttttttgaatttggcactaacaagtattcgttt
gaagtgtggagtacagaaaacctaagcgatgtagctaattataaaaaaaatcagccatta
tttgtgcatccattactgagtcagtttgacgagcttgccgcacttaataacaccataaac
caaggactcaaaatagcagttgtacaacatgcagcacgctgggtaaaagccgcaatagtt
aagcgcaagcaagagcaaagcgtgatcaccccagatgacttattgaccaatttacacagt
gcgcttaataacgagcaaggcgacgtactagcgcaaaaaattgcgcagttgtttccggtt
gccatgattgatgaattccaagataccgatccgattcagtacggtatttttagtaaaatt
tatgggcaacaaaataccacgcttgccatgataggcgaccccaagcaggctatttatggc
tttaggggcgcagatatttttacgtacattggcgcaaaagaagctgtacaaagtgatcag
caatttacgctggggactaactttcgctcaagcaccgatatagtcaatagcgttaatagt
ttatttggcaaacacgctaacagctttatttataacgacgctataccgtttaacgcagta
gctgctaaaggtaaaaaagcggaagactcttttttaattgatggcaaacccgcgaccgca
ttcgaatttaatgtatttgtggatgaagccgcagacgaaaaaaacaaaccaaccaacaaa
ggtgtagggcaagcacatttagccactcactttgctaataaaatagtgaccctgcttgaa
aaagcaaaacaaggggatgcgtgtattggcagtacccctgtaagcgctgccgatatttgt
atattagtgcgcgaccgtgttgaagcgcaaataatgaaaaaagcgctagatgatgccaaa
atttccagcgtgtatttatcgcgagaaagcgtttttagccaagagcttagccatcaccta
cttaactttttaacagcgctgcatggtcaatatgacgagtcattgctgcgcggtgtttta
gctggtccgctattttgtttaagttataacgaaatacatgcactcgccgatgatgaaaat
aaatggcaagactacttaaacttttttgcacaacttagccacatttggaacaagcaaggc
gctatggcaatgcttgagcgcttaatgagccacaaccaacttagcgctaaatggcaaggt
ttaggatataacgttgagcgttggctgacggactttaggcatttgggcgaaatacttcag
caaaagcaaatagagcttgaaggcacgctgcgtttgctgcgatggtttgcacaaaaggta
agccaacaagacggtgaaacagtacaagtgcgcctagaaagtgacgccaacttggttaaa
attgtcactatgcatgcttcaaaagggcttgaataccctttggtatttatgccgtttgcc
agtggctatcgcgaaacaaaagaagcgctttatcataataatggcaagctagtttacgat
ttaagtaaagacgaagatgcccttcaaaaagcagagcaagaacgcctagctgaagattta
cgcctgctatatgtagcacttactcgcgccgtacatttttgtgcgcttggtgtttataac
atagggcaaggacaaagtagccgcttggctatgcaaagtagtgcacttgggcatgtttta
tttgcagggcttgaacttgccagtagccaaacatggcgcacgcatttaagtgagttttgc
gacgctaacagcgcgatgagctatcagcaatttacctcacaaacattattagagcaggga
acactttgttttaataacagtgaaagtgcgcagcaaacgttaagtgttaataaagtaacg
gcaaatattgaacgtaactggcgagcaactagctttagtgcgttgagctttaaaaagcac
agcgaccaattagccccagggcgaagtgatgaagatcacgaaaaagacgagtttgcagtg
caagaggacgaaataccatcaccttatagttttcctaaagggccaaagccgggtagctgt
ttgcatgaaatatttgaacaaatagattttattagcccaatagttcacccaactaatacc
gagcaaaacttatctgaggtagttaagcgcagtcttgaaaagtatcacataggtgagcaa
tggcaagaggtggctgaaaaatgggtgcttgatgttcttgcgtgtcctctaaatgagggg
cttctttcattgggtgtgcttacaccaggtgactgcctagtcgaaatggaatttaattta
cctcttgagagtttaagcgcacctaagctaaacgaaatactgattaaacattttggtttt
gcacaaagtaagcttgaattttcgcaggtgaaaggcttgttaaaaggctttgtcgattta
atattttgctaccaaggtaaatattatattttagattataagtctaattatttaggtagc
acgcctgctgattacgagagcgacatgcttgagcaagcgatgagcagtcatcagtatcat
ttacagtatttaatctacacggtagcactgcatcgcttattaaaacaacgcatagctgat
tactcaatagaaacccatttaggcggtgtgtattacacctttttacgtgggatgccggca
gggcaaggcgtgtactttaaaaagctaactgtagagcaagtgattattttagagggctta
tttagccaaggagccatgctatga

DBGET integrated database retrieval system