KEGG   Pseudoalteromonas sp. Bsw20308: D172_009020Help
Entry
D172_009020       CDS       T04175                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pbw  Pseudoalteromonas sp. Bsw20308
Pathway
pbw00071  Fatty acid degradation
pbw00072  Synthesis and degradation of ketone bodies
pbw00280  Valine, leucine and isoleucine degradation
pbw00310  Lysine degradation
pbw00362  Benzoate degradation
pbw00380  Tryptophan metabolism
pbw00620  Pyruvate metabolism
pbw00630  Glyoxylate and dicarboxylate metabolism
pbw00640  Propanoate metabolism
pbw00650  Butanoate metabolism
pbw00900  Terpenoid backbone biosynthesis
pbw01100  Metabolic pathways
pbw01110  Biosynthesis of secondary metabolites
pbw01120  Microbial metabolism in diverse environments
pbw01130  Biosynthesis of antibiotics
pbw01200  Carbon metabolism
pbw01212  Fatty acid metabolism
pbw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pbw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D172_009020
   00630 Glyoxylate and dicarboxylate metabolism
    D172_009020
   00640 Propanoate metabolism
    D172_009020
   00650 Butanoate metabolism
    D172_009020
  09103 Lipid metabolism
   00071 Fatty acid degradation
    D172_009020
   00072 Synthesis and degradation of ketone bodies
    D172_009020
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D172_009020
   00310 Lysine degradation
    D172_009020
   00380 Tryptophan metabolism
    D172_009020
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    D172_009020
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D172_009020
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    D172_009020
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbw04147]
    D172_009020
Enzymes [BR:pbw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     D172_009020
Exosome [BR:pbw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D172_009020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALQ09754
Position
complement(2091756..2092937)
Genome map
AA seq 393 aa AA seqDB search
MTLESVVIVAAKRTPMGGFMGALSDAQSTELGATAIASALAQTGLANNAIDEVIMGCVLP
AGLGQAPARQAMLKAGLALSTGATTINKVCGSGLKAAMLANDLIKAGSIQSAIAGGMESM
TNAPYFIPKARGGMRMGHGEIKDHMMSDGLEDAYDNKAMGCFAQDTADEYGIGREQMDAF
ALGSLSKAKAAIQNGSFDNEVAPHTMQTRKGDVTVSIDEQPGNARPEKIPTLRAAFKKDG
TITAANSSSISDGGAALILMSESKAKEQGLTPLCKIVAHSTHSQKPSEFTVAPVGAMNSV
LEKAGWAVNDVDLWEINEAFAMVTMLAINELKLDESKVNVNGGACALGHPIGASGARILV
TLIHALKNRGLKKGIASLCIGGGEAVAMAVEAY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactttagaatcagtggtaattgtagcagcaaaacgcaccccaatgggtggttttatg
ggagcgttaagtgatgcacagtctaccgagcttggcgctaccgccattgccagcgcactt
gcacaaactggtttagctaataacgctatagatgaagtaattatgggctgcgtattacca
gcaggccttggacaagcacctgcacgccaagcaatgttaaaagcaggccttgcacttagc
actggcgctacaacaattaacaaagtatgtggctctggtttaaaagcggccatgcttgca
aacgatttaattaaagccggctctattcaatctgctattgctggtggcatggagagcatg
acaaacgcaccgtactttataccaaaagcgcgtggcggaatgcgcatggggcatggcgaa
ataaaagatcacatgatgagcgacggccttgaagatgcttacgataacaaagcaatgggt
tgttttgcacaagacaccgccgatgaatacggcattggccgcgagcaaatggatgcgttt
gcattaggctcattaagtaaagctaaagccgcgatacaaaatggtagctttgataacgaa
gttgcaccccatacaatgcaaacacgcaaaggcgatgtaacagtatcgattgatgagcaa
ccaggtaacgctcgcccagaaaaaattcctaccttacgtgcagcctttaaaaaagacggc
accattacagccgctaattcatcgtcaatttcagacggtggcgcagcgcttatattaatg
agcgaatcaaaagcaaaagagcagggcttaacaccgctttgtaaaattgtggcgcacagc
acgcattctcaaaaaccaagtgaatttacagtagcgccagtaggggctatgaacagcgtg
cttgaaaaagcaggttgggctgtaaacgatgttgacctttgggaaattaacgaagcattt
gccatggtaaccatgctggctataaacgagttaaaacttgatgaaagcaaagtaaacgtt
aacggcggtgcatgtgcacttggccacccaattggtgcaagcggcgcgcgtattttagta
acgctaattcatgcccttaaaaaccgaggccttaaaaaaggcattgcgtctttatgtatt
ggtggcggtgaagcggttgctatggccgtagaagcttactaa

DBGET integrated database retrieval system