KEGG   Pelobacter carbinolicus: Pcar_1397
Entry
Pcar_1397         CDS       T00285                                 

Name
(GenBank) glycerol dehydratase
Organism
pca  Pelobacter carbinolicus
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ABA88643
UniProt: Q3A4R4
Position
complement(1639045..1641444)
AA seq 799 aa
MSIQVKVNPAVASQGPTERVEKIKARFLATTPEICAERAKLITESYKETEGQPMSIRRAK
ALEKILLEMSVYIDDDELIVGNQCSMPRSAPIYPEFSCEWVEDELDRLAKRSADVFLISE
DVKKTLREDVFPYWKGKTNHEIATALMKQEAIDAGNAVVYTVGNYYFNGVGHISANYGKV
MNQGLNSVIAKAEAAKEKFDFADAHQMKSLHFLESTIIANKAVIAFANRFADEAESLAAA
EKNAARKAELLEIARICRKVPAEPAETFQEAVQAFWFIHLVIQIESNGHSISPMRFDQYC
YPFYAASKNSLSDEKAQEMLDLLWLKFNGLNKVRDENSTMAFAGYPMFMNIIVGGVDREG
KDATNELSLMLLQCAANTKLYAPSLSIRVHEGTPDVLYMKAAEVSRMGLGVPAYFNDRTI
IPALLSRGLTLEDARDYGIIGCVEPQVGGKTEGWHDAAFFNMAKVVELTLNNGYDKRTEM
QVGPKTGDVTEMKSFDDVMAAYAKQMEYFVGLMCHADNMVDLAHGQNVPLPFLSSLVEDC
IGRGKSLQEGGAIYNFSGPQGVGVANAGDSLTAIKKLCFDDKVISLPELKEVLDKDFAGA
EEIRQMVINRAPKYGNDDDYADEIAVESANIYCAEVNKYRNPRGGQFQPGLYPASANVPF
GGVVEATPDGRKKGTPLADGVSPIGGADISGPTATVNSVAKLDHEVTSNGTLLNQKFHPN
AVKGEEGLRNLIAVTETYFKNGGFHVQYNVIDRNTLLDAQKKPEDFKGLVVRVAGYSAFF
TALDKSLQDDIISRTEQVF
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgtctatccaagtaaaagttaaccccgctgtcgcatctcaaggtccgaccgaacgcgtc
gaaaaaatcaaagcccggttcctggccacgactccggaaatctgcgccgaaagggccaag
ctgatcaccgaatcctacaaggagaccgaaggtcagcccatgagcatccgccgcgccaag
gcgctggaaaagatcctcctggaaatgtcggtctacatcgacgacgacgaactgatcgtc
ggcaaccagtgcagcatgccccgctccgctccgatctatcccgaattctcctgcgaatgg
gtggaagatgaactcgaccgcctggccaagcgcagcgccgatgttttcctgatcagcgaa
gacgtcaagaaaacccttcgcgaagatgtcttcccctactggaaaggcaaaaccaaccac
gagatcgctaccgcgctgatgaagcaggaagccatcgacgccggcaatgcggttgtctac
accgtcggtaactactacttcaatggcgtcggccacatttcggccaactacggcaaggtc
atgaaccagggtctcaacagcgtcatcgccaaagccgaagccgccaaggaaaagttcgac
ttcgccgacgctcaccagatgaaatcgctgcacttccttgaatcgaccatcatcgccaac
aaggccgtgatcgcctttgccaatcgctttgccgacgaagccgagagcctcgccgcagcg
gagaaaaacgccgcccgcaaagccgaactgctcgagatcgcccgtatctgccgtaaggta
ccggccgagcctgctgaaaccttccaggaagcagtgcaggctttctggttcatccacctg
gtcatccagatcgaatccaacgggcactccatctcgcccatgcgcttcgaccagtattgt
taccccttctacgcggccagcaaaaactccttgtcggacgaaaaagctcaggaaatgctt
gaccttttatggcttaaattcaacggcctcaacaaagtacgcgacgaaaactccaccatg
gctttcgccggctatccgatgttcatgaacatcatcgtcggcggcgtggatcgcgaaggc
aaggatgcgaccaacgagctgtctctgatgctcctgcagtgcgctgccaataccaagctc
tacgcgccttccctgtccatccgtgtccatgaaggaactccggacgtgctgtacatgaaa
gccgccgaagtcagccgcatgggtctgggcgtaccggcttacttcaacgaccgcaccatc
attccggccctgctgtcccgcggcctgaccctggaagacgcccgtgactacggcatcatc
ggctgcgtcgagccgcaggtgggcggcaaaaccgaaggctggcacgatgccgctttcttc
aacatggccaaagtcgttgagctgacccttaacaacggttacgacaaacgtaccgaaatg
caggtcggtcccaaaaccggcgacgtcaccgaaatgaagagttttgacgacgtcatggcc
gcctatgccaagcagatggaatatttcgtcggcctgatgtgtcatgccgacaacatggtc
gatctggcccacggccagaatgtccccctgcccttcctctccagcctggtcgaagactgc
atcggccgcggcaagtcgttgcaggaaggcggcgccatctacaacttcagcggcccgcag
ggcgtgggcgtggccaatgccggcgactccctgaccgccatcaaaaagctgtgcttcgat
gacaaagtcatcagcctgccggagctcaaggaagttctcgacaaggacttcgcaggtgcc
gaggaaatccgccagatggtcatcaaccgcgcgcccaagtacggcaacgacgatgactat
gccgatgaaatcgccgtcgaatcggccaatatctactgcgccgaagtcaacaaataccgc
aacccccgcggcggccagttccagcccggcctctacccggcatccgccaacgtgcctttc
ggcggcgttgttgaagcgactccggacggccgtaaaaaaggcacccccctggctgacggc
gtgtcccccatcggcggtgcggacatctccggcccgaccgctacggtcaactcggtcgcc
aaactggaccatgaagtcacctccaacggcaccctgctcaatcagaagttccaccccaat
gccgtcaagggtgaggaaggcctgcgcaaccttatcgcagtgaccgaaacctacttcaaa
aacggcgggttccacgtgcagtacaacgtcatcgaccgcaacacgctgctcgacgcccag
aaaaaacccgaagatttcaaagggctggtagtacgtgtcgccggttacagcgcattcttc
accgcgctggacaaatcgctgcaggacgacatcatttcccgtaccgagcaggtcttttaa

DBGET integrated database retrieval system