KEGG   Pelobacter carbinolicus: Pcar_0024Help
Entry
Pcar_0024         CDS       T00285                                 

Gene name
waaD
Definition
(GenBank) ADP-L-glycero-D-mannoheptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00540  Lipopolysaccharide biosynthesis
pca01100  Metabolic pathways
Module
pca_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:pca00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Pcar_0024 (waaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pca01005]
    Pcar_0024 (waaD)
Enzymes [BR:pca01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     Pcar_0024 (waaD)
Lipopolysaccharide biosynthesis proteins [BR:pca01005]
 Unusual sugar
  Pcar_0024 (waaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 KR
Motif
Other DBs
NCBI-ProteinID: ABA87287
UniProt: Q3A8K5
Position
26990..27937
Genome map
AA seq 315 aa AA seqDB search
MLIVTGGAGFIGSNIVQALNARGREDILVVDDLTDGTKFANIADARICDYLDKDEFLRRI
ASGDSFGDRIEAIIHQGACSTTTEWDGRYMMENNYAYSKTLLHYCLERRIPFLYASSAAT
YGGGQVFCEEPQYERPLNVYGYSKALFDQYVRRVLPTADSQVAGFRYFNVYGPREQHKGS
MASVAFHLRNQLLKDGSVNLFEGCDGYGDGEQRRDFIYVGDVVDVNLWFLDHPEVSGIYN
VGTGRSQTFNDVAHAVLKAHEGGELQYVPFPEHLKGRYQSFTEADLTRLRGAGFDGSFLT
VEEGVARYMEWLQQN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcttattgttaccggcggagccggttttattggcagcaatatcgtacaggccctcaat
gcgcgcgggcgagaagatatcctggtcgtcgacgatttgaccgacggtaccaaattcgcg
aatatcgccgatgcgcgaatctgcgattatctcgataaggatgaatttctccggcgcatc
gcttccggcgacagcttcggtgaccggattgaagccatcattcatcagggcgcctgttcg
acgaccaccgagtgggacggacgttacatgatggagaacaattacgcctactccaagacc
ttgctgcattactgtctggagcggcgcattccttttctgtatgcgtccagcgcggcgact
tacggcggtggccaggtgttttgcgaggagccgcagtacgagcggcctctcaacgtctac
ggctattccaaggcgctgttcgatcagtacgtgcggcgtgtgctgcccaccgccgacagc
caggtagcgggttttcgctatttcaatgtctatgggccgcgggagcagcacaaagggagc
atggccagtgtcgccttccatttgcgcaaccagttgctcaaggacggcagcgtcaatctg
tttgaagggtgcgacggatacggcgacggcgagcagcggcgtgattttatctatgtcggc
gatgtggtcgacgtcaatctgtggtttcttgaccaccctgaggtatcgggtatttacaat
gtcggtaccggacgcagccagacctttaacgatgtcgcccacgcggtgctgaaggctcac
gaggggggcgaattgcagtacgtgccgttccccgagcatctcaagggtcgctatcagagt
tttaccgaagcggatctgacccgtttgcgcggtgccggttttgacggcagcttcctgacc
gtcgaggagggcgtggcgcgttacatggaatggctgcagcagaactga

DBGET integrated database retrieval system