KEGG   Pelobacter carbinolicus: Pcar_0330Help
Entry
Pcar_0330         CDS       T00285                                 

Gene name
budX
Definition
(GenBank) (2R,3R)-2,3-butanediol/meso-2,3-butanediol dehydrogenase, putative
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Pcar_0330 (budX)
Enzymes [BR:pca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Pcar_0330 (budX)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Pcar_0330 (budX)
    1.1.1.-  
     Pcar_0330 (budX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Fer4
Motif
Other DBs
NCBI-ProteinID: ABA87590
UniProt: Q3A7Q4
Position
414965..416032
Genome map
AA seq 355 aa AA seqDB search
MAETMKAAVWHAKKDIRVEEVPVPAPPKADEVQIKVDYCGICGSDLHEYLAGPIFIPTEP
HPLTGHSGKTILGHEFSGTVVAVGSNVTTVRVGDKVAPDACQHCGTCVTCREGRYNVCEK
LAFTGLMAEGAFAKYVNVPSNIVYVLPEGVTQEDAALIEPIATGFKAVRMAGTILGETIV
VFGAGTIGLATLQCAKAAGAGRCIVVEMSAARKALAKECGADVILDPKECDVIAEIKKLT
GGSGADVSFECIGNKITGPLAVEAIRNNGRAVIVGIFEEPSSFNFFSLSATDKKVIGTLA
YTLDDFKGVSLLLANGAIKAAPMITGKIELDDIVDKGFEELVNNKDAHIKILVKP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaacgatgaaggcagcagtatggcatgcaaaaaaagacatccgcgtagaggaa
gtacctgtaccggctccgcccaaggctgacgaagttcagatcaaagtggattactgtggt
atctgcggatccgacctgcatgaatacctcgcaggcccgatctttatccccaccgagccc
catcccctgaccggccacagcggcaagaccattctggggcatgaattctccggtacggtc
gtggccgttggctccaatgttaccaccgtgcgggttggcgacaaagtcgctcccgatgca
tgtcagcactgcggcacctgcgttacctgccgcgaagggcgctacaacgtctgcgaaaaa
ctggcttttaccggtctgatggccgaaggcgcgttcgccaaatacgttaacgttccctcc
aatatcgtctatgtgcttcccgaaggtgtcactcaggaagacgcagctctgatcgagccc
atcgccaccggtttcaaagccgtgcgcatggccggcaccatcctcggcgagaccatcgtg
gttttcggcgcgggtactatcggtctcgctaccctgcagtgtgccaaggctgccggcgcc
ggtagatgcatcgttgttgaaatgtccgccgctcgcaaggccctggccaaagagtgtggc
gccgacgttattctcgatcccaaagaatgcgacgttatcgccgaaatcaagaagctgacc
ggcggttccggtgccgacgtatccttcgagtgtatcggcaacaagatcaccggccctctg
gctgtagaagctattcgtaacaacggccgtgccgttatcgtcgggattttcgaagagccc
agctctttcaacttcttcagcctcagtgctaccgacaagaaggttatcggtaccctggct
tacaccctggatgacttcaaaggcgtaagtctgctgctggccaacggcgcaatcaaagcc
gctccgatgatcaccggcaaaattgagctcgacgatatcgtcgacaaaggttttgaagag
ctggtcaacaacaaggatgcccatatcaagatccttgtaaaaccttaa

DBGET integrated database retrieval system