KEGG   Pelobacter carbinolicus: Pcar_0400Help
Entry
Pcar_0400         CDS       T00285                                 

Definition
(GenBank) hypothetical protein
Organism
pca  Pelobacter carbinolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ANKH
Motif
Other DBs
NCBI-ProteinID: ABA87660
UniProt: Q3A7I4
Position
complement(490377..491660)
Genome map
AA seq 427 aa AA seqDB search
MTETAPLSLRQISRFFFPLMLNVQLMSFSHNIINMALARQNDAVTNLAAFAVALALHLFL
ASPGYQNHTIALALIRGKRSLRSVSVFVIAASSAISVMLSLIAWTSLGQIVFVQLIGVSP
QLATQARSVIAILAFLPFFTGLRGLCQGIVIRARHTELVSLATLVRLFTLVIILLLAARH
IPGPQLGALGLVGCIAVESLFMLWFACACGLGPAGPAKEEFGVRDTFRYSLPLAFSSAMQ
QVVPLLISAIISRLPDATLALAALGVIRGFIFLLAGPMRNLQQAYLALVHTRHDYRMLMR
FFRLVAAGMAVIMLAVAYPLNLPVLGWGMGLETELRNYIALPLASCALFPVLYGAVNLWR
GLFAQCHSTGVLGWATVAKVGYLALVWPLATLSPIPISGIALAVFLLLSCEYCEAWYLNR
RRRQLNT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaacagcccccctgtccctgcgacagatctcccgctttttctttcccctcatg
ctcaatgtgcagctgatgagcttttcccacaatatcatcaacatggccctggctcgccag
aacgatgccgtgaccaatctggccgccttcgcggtggccctggccctgcatctgttcctc
gcctcgccgggttatcagaatcacaccatcgccctggccctgattcgcggaaaacgttct
ttgcgcagcgtatcggtgttcgtcatcgccgcatcgagcgccatctccgtcatgctgtcc
ctcattgcctggacctcccttggacaaattgtttttgtgcaacttatcggcgtatcgccg
caactggccacccaggcccgttcagttatcgctatcctcgcctttttaccgtttttcacc
ggcctgcggggactgtgccaggggatcgtgatacgggcgcgccataccgaactggtttcc
cttgccaccctggtgaggctttttacgttggtgatcattctgctgttggccgcccgacat
atacccggcccgcaactcggcgccctgggactggtcggctgcatcgccgtggaaagcctg
ttcatgctctggtttgcctgcgcctgcggcctcggcccagcgggccctgccaaagaagaa
ttcggcgtacgggatacgttccgatacagcctgccgctggctttttcatcggccatgcaa
caggtcgttcccctgttgatcagcgccatcatcagccgtctgcccgacgccaccctggcc
ctggcggcccttggcgtcattcgcggctttatctttctgctggcagggccgatgcgcaac
ctgcagcaggcctatctggccctggtgcacaccagacatgactaccgcatgctgatgcgt
ttttttcgcctggtcgccgcaggcatggcagtgatcatgctggccgtagcctatcccctc
aacctgccggtactcggctggggcatggggctggaaaccgaattgcgcaactatatagcc
ctgccgctggccagttgtgccctttttcccgtgctgtacggcgcggtcaatctatggcgc
ggcctgtttgcccaatgtcacagcaccggcgtgctgggctgggccactgtcgccaaggtc
ggttacctggcgctggtctggcccctggccacgctcagcccgattcccatatcgggaatc
gctctggcggttttcctgctgctgtcgtgcgaatactgcgaagcctggtatctgaatcgc
cgtcgccgtcagctcaatacctga

DBGET integrated database retrieval system