KEGG   Pelobacter carbinolicus: Pcar_0519
Entry
Pcar_0519         CDS       T00285                                 

Name
(GenBank) autotransporter domain outer membrane protein, putative
Organism
pca  Pelobacter carbinolicus
SSDB
Motif
Pfam: Legionella_OMP OMP_b-brl CCCAP HIP1_clath_bdg Autotransporter Lebercilin WEMBL
Other DBs
NCBI-ProteinID: ABA87779
UniProt: Q3A8N9
Position
complement(628934..630112)
AA seq 392 aa
MRKIIVAVLAMAILPGIAWAQEPSNQELYQMIQQMERKYDAAIKETDRALAEARAEAAKA
KEEAAKAKAELARLKAEPRPAAAALQAEATPLIKAPETTPGFKASAEVLYMRPSRANLDF
AIKDPDNDSYPEGTVSEIEPDYQLGGRFGLGYDLGSGTEIGVQFTGLKSHDSESATASSS
GSLWGLWLHADASIDDQNVDTAKARYDFEHYAIDLNARQNLDIGRHLGLSLEGGLRYASM
NQDFDIVYRQNTTEVAINSENHFSGWGPRLGLGLDWRVGYGFNVFSSVAGSVLMGDFDLS
YHDQDGTTTRVNMKQGIHNRIIPVVEMKLGVGYAQRLKNGWTIGANAGYEWQNWFNMVTT
HHFSDDVDPQIMDSDTTDVSLDGFFFEGFIHF
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgcggaaaattatcgtagccgtgctcgcgatggccattctgccaggaattgcctgggca
caggagccaagtaaccaagaactctaccagatgatccaacagatggaacgcaaatacgac
gcggccatcaaagagacagatcgggctttggcagaggccagagcggaagcagccaaagct
aaagaagaagcggccaaagccaaagcggaactggcgcggctcaaagcggagccccgcccc
gccgcagctgccttgcaagcagaggcaacgcccctgatcaaagctccggaaaccacccct
ggattcaaggcttccgccgaggttctctacatgcgtccatcccgggctaatctcgatttt
gctatcaaagatcccgataatgattcctaccccgaaggtaccgtcagcgaaatcgagccc
gactatcagcttggcgggcgtttcggtctgggatacgatttgggatcaggtactgaaatc
ggcgtgcagttcaccggcctcaaatcccatgacagcgaatccgccacggcatcatcgagc
ggctctttatggggtctctggctacatgcggacgcctctatcgacgaccaaaatgtcgac
acagccaaggctcgctatgatttcgaacactacgccatcgatctgaacgcccgacagaac
ctggatatcggccgacacctcggcctgagcctggaaggcggtttgcgctacgccagcatg
aaccaggatttcgacatagtatatcgccagaacactaccgaagttgcaatcaactccgaa
aaccacttctcgggatggggaccccgccttgggctcggtctcgactggcgcgtaggatac
ggctttaacgtcttcagttcggtcgccggctctgtgctgatgggcgatttcgacctgtct
taccacgatcaggacggcaccacaaccagggtgaatatgaaacagggcatccacaaccgc
atcatccccgtagtcgagatgaaactcggggtcggctatgcccagcgactcaaaaacgga
tggaccattggcgccaatgccggttacgaatggcaaaactggttcaacatggtgacgacg
catcatttttcagacgatgtcgaccctcaaattatggatagcgacaccacagatgtcagc
cttgacgggttctttttcgagggtttcatccacttttag

DBGET integrated database retrieval system