KEGG   Pelobacter carbinolicus: Pcar_0706Help
Entry
Pcar_0706         CDS       T00285                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pca  Pelobacter carbinolicus
Pathway
pca03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pca00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Pcar_0706 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pca03011]
    Pcar_0706 (rplV)
Ribosome [BR:pca03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Pcar_0706 (rplV)
  Bacteria
    Pcar_0706 (rplV)
  Archaea
    Pcar_0706 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF3084
Motif
Other DBs
NCBI-ProteinID: ABA87965
UniProt: Q3A6P2
Position
856005..856337
Genome map
AA seq 110 aa AA seqDB search
MEAKAKLRYVRLSPRKTRLVVDMVRGKKVQEALNILRFSPQKAASIVYQLVGSAVANAEQ
KGVADVDRLFIESISVDQGPVLKRFMPRAQGRATRIRKPTSHITVVLNEK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagctaaggccaagcttaggtatgtgcgtctgtcgcctcgtaagacccgacttgtg
gtcgatatggtgcgcggaaaaaaagttcaagaggcgctgaatattctgaggttttcgccc
cagaaagcggccagcattgtttatcagctggtaggttcggctgtggccaacgccgagcaa
aagggggtagctgacgtcgaccggctctttatcgagagtatttccgtcgaccagggaccg
gtgcttaagcgctttatgccgcgggcacagggccgggccacccggatccgtaaaccgacc
agccacattactgtggttctgaacgaaaaataa

DBGET integrated database retrieval system